Help  Custom Search
 
molecular chaperone heat shock protein of Agrobacterium radiobacter str. K84

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone heat shock protein

Synonymous Names

B9JC13_AGRRK, HSP70, Heat shock 70 kDa protein, Heat shock protein 70

Taxon Information

Organism

Agrobacterium radiobacter str. K84

Organism ID

311403 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium radiobacter K84

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MARALGLDFGTTNTVLALADGPATQSVAFTSAAGTADSMRTALSFMKDPGLGAAALKVEAGHAAIRQFID NPGDCRFLQSIKTFAASALFQGTLIYAKRHTFEDLMEIFVRRLRAYAGDGWPAEVGRIVAGRPVHFAGAN PDPELATARYNEALSRFGFPEIHYVYEPVAAAFYFAQHLKTDATVLVADFGGGTTDYSLIRFESHAGRLT ATPIGHSGVGIAGDHFDFRMIDNIVSPEIGKGSYFKSFDKLLEVPTSYYANFGRWNQLSIFKTSREYADL KKLVRSSMEPDKLETFIDLVEHDEGYPLYQAVSATKMALSAEEEAEFNFPPLGKAGHKTVRRADFERWIG DDLTRIEGALDDVLTRTNTSPDTIDKVFLTGGTSFVPAVRRIFTERFGQERIETGGELLSIAHGLALIGE RDDISQWTA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTCGGGCGCTTGGTCTTGACTTCGGCACAACGAATACGGTTCTGGCTCTGGCCGACGGTCCAGCGACGCAATCGGTCGCCTTCAC
CAGTGCGGCCGGCACGGCGGACAGCATGCGTACCGCACTGTCTTTCATGAAGGATCCGGGATTGGGTGCCGCGGCCCTGAAGGTCGAGGC
GGGGCATGCCGCCATCCGGCAGTTCATCGACAATCCCGGCGACTGTCGCTTTCTGCAATCGATCAAGACCTTTGCCGCCAGCGCGCTCTT
CCAGGGCACGCTGATCTATGCCAAGCGCCATACGTTCGAAGATCTGATGGAGATCTTCGTGCGCCGCCTGCGCGCCTATGCCGGCGATGG
CTGGCCGGCGGAGGTCGGCCGCATCGTTGCGGGCCGGCCGGTGCATTTCGCCGGCGCCAATCCTGATCCGGAGCTTGCCACCGCACGCTA
CAACGAGGCGCTATCGCGCTTCGGCTTTCCCGAGATCCATTATGTCTACGAGCCGGTGGCAGCCGCCTTTTACTTCGCCCAGCATCTGAA
GACGGATGCGACCGTGCTGGTCGCCGATTTCGGCGGCGGCACGACGGACTATTCGCTGATCCGCTTCGAGAGCCATGCCGGCCGGCTGAC
GGCGACCCCCATCGGCCATTCCGGCGTCGGCATCGCCGGCGACCATTTCGACTTCCGGATGATCGACAACATCGTCTCGCCGGAGATCGG
CAAGGGCAGCTACTTCAAGAGCTTCGACAAGCTGCTGGAAGTGCCCACCTCCTACTACGCCAATTTCGGCCGCTGGAACCAGCTTTCGAT
CTTCAAGACCTCGCGCGAATATGCCGACCTGAAGAAGCTGGTGCGCAGCAGCATGGAGCCGGACAAGCTGGAAACCTTCATCGATCTCGT
CGAGCATGACGAGGGCTATCCGCTCTATCAAGCGGTGTCGGCGACGAAGATGGCGTTGTCGGCCGAAGAGGAGGCAGAATTCAATTTCCC
GCCGCTCGGCAAGGCTGGCCACAAGACGGTGCGCCGCGCCGATTTCGAGCGCTGGATCGGCGACGATCTCACCCGCATCGAGGGCGCGCT
GGATGACGTGCTGACCAGGACCAACACGTCTCCCGACACCATCGACAAGGTGTTCCTCACCGGCGGCACCTCCTTCGTGCCGGCGGTGCG
CCGCATCTTCACGGAGCGCTTCGGTCAAGAGCGGATCGAGACCGGCGGCGAATTGCTTTCGATCGCCCACGGTCTCGCCCTGATCGGCGA
GCGCGACGACATCAGCCAGTGGACGGCGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine23118 %
Guanine39831 %
Thyamine24119 %
Cytosine42033 %
A+T47237 %
G+C81864 %

Total Bases :   1290 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC25923
GCGCGC33823
CGGCGGCGG56933
CGCGCG82023
GCAGCAGCA85333
GCGCGC107223

Microsatellite Map

ATGGCTCGGGCGCTTGGTCTTGACTTCGGCACAACGAATACGGTTCTGGCTCTGGCCGACGGTCCAGCGACGCAATCGGTCGCCTTCACC
AGTGCGGCCGGCACGGCGGACAGCATGCGTACCGCACTGTCTTTCATGAAGGATCCGGGATTGGGTGCCGCGGCCCTGAAGGTCGAGGCG
GGGCATGCCGCCATCCGGCAGTTCATCGACAATCCCGGCGACTGTCGCTTTCTGCAATCGATCAAGACCTTTGCCGCCAGCGCGCTCTTC
CAGGGCACGCTGATCTATGCCAAGCGCCATACGTTCGAAGATCTGATGGAGATCTTCGTGCGCCGCCTGCGCGCCTATGCCGGCGATGGC
TGGCCGGCGGAGGTCGGCCGCATCGTTGCGGGCCGGCCGGTGCATTTCGCCGGCGCCAATCCTGATCCGGAGCTTGCCACCGCACGCTAC
AACGAGGCGCTATCGCGCTTCGGCTTTCCCGAGATCCATTATGTCTACGAGCCGGTGGCAGCCGCCTTTTACTTCGCCCAGCATCTGAAG
ACGGATGCGACCGTGCTGGTCGCCGATTTCGGCGGCGGCACGACGGACTATTCGCTGATCCGCTTCGAGAGCCATGCCGGCCGGCTGACG
GCGACCCCCATCGGCCATTCCGGCGTCGGCATCGCCGGCGACCATTTCGACTTCCGGATGATCGACAACATCGTCTCGCCGGAGATCGGC
AAGGGCAGCTACTTCAAGAGCTTCGACAAGCTGCTGGAAGTGCCCACCTCCTACTACGCCAATTTCGGCCGCTGGAACCAGCTTTCGATC
TTCAAGACCTCGCGCGAATATGCCGACCTGAAGAAGCTGGTGCGCAGCAGCATGGAGCCGGACAAGCTGGAAACCTTCATCGATCTCGTC
GAGCATGACGAGGGCTATCCGCTCTATCAAGCGGTGTCGGCGACGAAGATGGCGTTGTCGGCCGAAGAGGAGGCAGAATTCAATTTCCCG
CCGCTCGGCAAGGCTGGCCACAAGACGGTGCGCCGCGCCGATTTCGAGCGCTGGATCGGCGACGATCTCACCCGCATCGAGGGCGCGCTG
GATGACGTGCTGACCAGGACCAACACGTCTCCCGACACCATCGACAAGGTGTTCCTCACCGGCGGCACCTCCTTCGTGCCGGCGGTGCGC
CGCATCTTCACGGAGCGCTTCGGTCAAGAGCGGATCGAGACCGGCGGCGAATTGCTTTCGATCGCCCACGGTCTCGCCCTGATCGGCGAG
CGCGACGACATCAGCCAGTGGACGGCGTGA

Gene Information
Molecule Type genomic DNA
Bases 1290 Bases
Molecular Weight398082.93 Da
Coding Sequence complement(CP000628.1:1207488..1208777)
NCBI ReferenceACM25934
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
HSP70 98 to 243 146 Hsp70 protein family PF00012
HSP70 281 to 420 140 Hsp70 protein family PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_AGRA3

Accession Number

HSP70_0023

Added on

2012-02-02

Updated On

2014-01-20