Help  Custom Search
 
Chaperone protein (Heat shock protein 70) of Agrobacterium radiobacter str. K84

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein (Heat shock protein 70)

Synonymous Names

B9JP34_AGRRK, HSP70, Heat shock 70 kDa protein, Heat shock protein 70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

Arad_7918

Gene Identifier

7367447

Taxon Information

Organism

Agrobacterium radiobacter str. K84

Organism ID

311403 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium radiobacter K84

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MVKVIGIDLGTTNSCVAVMEGKNTRIIENSEGARTTPSIVAFTSDGERLVGQPARRQAVTNPTNTIFAVK RLIGRRYDDPTVEKDKGLVPYKIVKAGNGDAWVEAEGKTYSPSQISAFILQKMKETAEANLGEKVSQAVI TVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLEKKKQAKIAVYDLGGGTFDVSILDIGDGV FEVKATNGDTFLGGEDFDMRLVNYLADEFQREQGIDLRKDKLALQRLKEAAEKAKIELSTSTQTEVNLPF ITADATGPKHLQVKITRAKFESLVEDLVQRTIEPCLSALKDAGLTANEISEVVLVGGMTRMPKIQEIVQK IFGKEPHKGVNPDEVVAVGAAIQAGVLQGDVKDVLLLDVTPLSLGLETLGGVFTRLIERNTTVPAKKSQV FSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIPAAPRGVPQIEVTFDIDANGIVNVSAKDKGTGK EQRIQIQASGGLSEADIERMVKDAEAHAVEDKKRKEAVEAKNSAEALLHATEKGVAEHGENLSEADRRAI ENAMADLREAVKGDDASAISAKASALQQQSTKLAEAAQAGAQSPSDTSASQAANDDVVDAEFTEVEDDDK KTSP

FASTA Format Composition Secondary Structure

Nucleotide
 GTGGTCAAAGTCATCGGAATCGATTTGGGAACGACCAATTCTTGCGTAGCCGTCATGGAGGGCAAGAATACGCGGATTATCGAAAATTC
CGAAGGCGCGCGTACGACGCCTTCGATTGTTGCGTTTACAAGTGACGGTGAGCGCCTGGTTGGGCAGCCGGCCCGACGGCAGGCGGTGAC
CAATCCCACCAACACAATCTTTGCCGTGAAGCGTTTGATCGGTCGCCGTTACGACGATCCGACCGTCGAAAAGGACAAGGGGCTGGTTCC
CTACAAAATCGTCAAGGCCGGGAACGGCGACGCCTGGGTCGAGGCCGAGGGCAAGACCTACTCGCCGTCGCAAATATCGGCTTTCATCCT
ACAGAAGATGAAGGAAACGGCGGAAGCCAATCTTGGTGAGAAGGTGAGCCAGGCGGTCATCACCGTGCCGGCCTATTTCAACGACGCGCA
ACGTCAGGCTACGAAGGACGCCGGTAAGATCGCCGGTCTGGAAGTCCTGCGCATCATCAACGAGCCGACAGCGGCAGCGCTTGCCTACGG
GCTTGAGAAGAAGAAGCAGGCCAAGATCGCGGTGTACGATCTCGGCGGCGGCACCTTCGACGTTTCCATTCTCGATATCGGCGACGGCGT
CTTCGAGGTGAAGGCGACCAACGGCGATACGTTCCTGGGCGGTGAAGATTTCGACATGCGCCTTGTCAATTATCTGGCGGATGAATTCCA
GCGCGAGCAAGGGATAGATCTGAGAAAGGACAAGCTTGCTCTGCAGCGTCTGAAGGAAGCTGCGGAAAAAGCCAAGATCGAGCTTTCCAC
ATCCACACAGACCGAAGTCAATCTGCCGTTCATTACGGCGGACGCTACCGGCCCGAAACATCTCCAGGTCAAGATCACGCGGGCGAAGTT
TGAGTCACTGGTTGAAGATCTCGTGCAGAGGACTATCGAGCCCTGTCTCAGCGCGCTCAAGGATGCCGGCCTGACAGCCAACGAGATCAG
CGAGGTGGTGCTGGTCGGTGGTATGACCAGAATGCCGAAAATCCAGGAAATCGTGCAGAAGATTTTCGGCAAGGAGCCGCATAAGGGTGT
CAACCCGGACGAGGTGGTTGCGGTCGGTGCGGCGATCCAGGCTGGCGTGCTGCAAGGCGACGTCAAGGATGTCCTGCTTCTCGACGTCAC
CCCATTGTCGCTCGGCCTTGAAACATTGGGTGGCGTCTTCACGCGTCTCATTGAGCGCAACACCACTGTGCCGGCTAAGAAGAGCCAGGT
GTTCTCGACTGCCGAGGATAACCAGAATGCCGTCACGATCCGCGTTTTTCAGGGCGAGCGTGAAATGGCCGCCGATAACAAGATGCTCGG
GCAGTTTGACCTGATGGGCATTCCGGCGGCACCACGCGGCGTGCCGCAAATCGAAGTGACCTTCGATATCGACGCCAACGGCATCGTCAA
TGTCTCGGCGAAGGACAAGGGCACGGGCAAGGAGCAGCGCATCCAGATTCAAGCCTCGGGCGGCCTGTCGGAGGCCGACATCGAAAGAAT
GGTCAAGGACGCGGAAGCGCATGCCGTCGAAGACAAGAAGCGCAAGGAAGCTGTGGAGGCAAAGAATTCTGCGGAAGCACTGCTGCATGC
GACCGAGAAGGGCGTGGCGGAACATGGTGAAAATCTGTCGGAGGCCGATCGCCGCGCGATCGAAAATGCGATGGCGGACCTGCGCGAAGC
AGTGAAAGGCGACGACGCATCCGCGATCAGTGCAAAAGCGAGCGCCCTGCAACAGCAGTCAACGAAACTGGCGGAGGCGGCTCAAGCGGG
GGCGCAGAGCCCGTCCGATACCAGCGCGTCTCAGGCTGCCAATGACGATGTCGTCGATGCCGAATTCACCGAGGTGGAAGACGACGACAA
AAAGACCTCACCGTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine46425 %
Guanine60432 %
Thyamine32718 %
Cytosine51027 %
A+T79142 %
G+C111459 %

Total Bases :   1905 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC9423
AGAAGAAGA54433
CGGCGGCGG58133
CACACA81223
GCGCGC94923
CGCGCG167123
GACGACGAC187833

Microsatellite Map

GTGGTCAAAGTCATCGGAATCGATTTGGGAACGACCAATTCTTGCGTAGCCGTCATGGAGGGCAAGAATACGCGGATTATCGAAAATTCC
GAAGGCGCGCGTACGACGCCTTCGATTGTTGCGTTTACAAGTGACGGTGAGCGCCTGGTTGGGCAGCCGGCCCGACGGCAGGCGGTGACC
AATCCCACCAACACAATCTTTGCCGTGAAGCGTTTGATCGGTCGCCGTTACGACGATCCGACCGTCGAAAAGGACAAGGGGCTGGTTCCC
TACAAAATCGTCAAGGCCGGGAACGGCGACGCCTGGGTCGAGGCCGAGGGCAAGACCTACTCGCCGTCGCAAATATCGGCTTTCATCCTA
CAGAAGATGAAGGAAACGGCGGAAGCCAATCTTGGTGAGAAGGTGAGCCAGGCGGTCATCACCGTGCCGGCCTATTTCAACGACGCGCAA
CGTCAGGCTACGAAGGACGCCGGTAAGATCGCCGGTCTGGAAGTCCTGCGCATCATCAACGAGCCGACAGCGGCAGCGCTTGCCTACGGG
CTTGAGAAGAAGAAGCAGGCCAAGATCGCGGTGTACGATCTCGGCGGCGGCACCTTCGACGTTTCCATTCTCGATATCGGCGACGGCGTC
TTCGAGGTGAAGGCGACCAACGGCGATACGTTCCTGGGCGGTGAAGATTTCGACATGCGCCTTGTCAATTATCTGGCGGATGAATTCCAG
CGCGAGCAAGGGATAGATCTGAGAAAGGACAAGCTTGCTCTGCAGCGTCTGAAGGAAGCTGCGGAAAAAGCCAAGATCGAGCTTTCCACA
TCCACACAGACCGAAGTCAATCTGCCGTTCATTACGGCGGACGCTACCGGCCCGAAACATCTCCAGGTCAAGATCACGCGGGCGAAGTTT
GAGTCACTGGTTGAAGATCTCGTGCAGAGGACTATCGAGCCCTGTCTCAGCGCGCTCAAGGATGCCGGCCTGACAGCCAACGAGATCAGC
GAGGTGGTGCTGGTCGGTGGTATGACCAGAATGCCGAAAATCCAGGAAATCGTGCAGAAGATTTTCGGCAAGGAGCCGCATAAGGGTGTC
AACCCGGACGAGGTGGTTGCGGTCGGTGCGGCGATCCAGGCTGGCGTGCTGCAAGGCGACGTCAAGGATGTCCTGCTTCTCGACGTCACC
CCATTGTCGCTCGGCCTTGAAACATTGGGTGGCGTCTTCACGCGTCTCATTGAGCGCAACACCACTGTGCCGGCTAAGAAGAGCCAGGTG
TTCTCGACTGCCGAGGATAACCAGAATGCCGTCACGATCCGCGTTTTTCAGGGCGAGCGTGAAATGGCCGCCGATAACAAGATGCTCGGG
CAGTTTGACCTGATGGGCATTCCGGCGGCACCACGCGGCGTGCCGCAAATCGAAGTGACCTTCGATATCGACGCCAACGGCATCGTCAAT
GTCTCGGCGAAGGACAAGGGCACGGGCAAGGAGCAGCGCATCCAGATTCAAGCCTCGGGCGGCCTGTCGGAGGCCGACATCGAAAGAATG
GTCAAGGACGCGGAAGCGCATGCCGTCGAAGACAAGAAGCGCAAGGAAGCTGTGGAGGCAAAGAATTCTGCGGAAGCACTGCTGCATGCG
ACCGAGAAGGGCGTGGCGGAACATGGTGAAAATCTGTCGGAGGCCGATCGCCGCGCGATCGAAAATGCGATGGCGGACCTGCGCGAAGCA
GTGAAAGGCGACGACGCATCCGCGATCAGTGCAAAAGCGAGCGCCCTGCAACAGCAGTCAACGAAACTGGCGGAGGCGGCTCAAGCGGGG
GCGCAGAGCCCGTCCGATACCAGCGCGTCTCAGGCTGCCAATGACGATGTCGTCGATGCCGAATTCACCGAGGTGGAAGACGACGACAAA
AAGACCTCACCGTAG

Gene Information
Molecule Type genomic DNA
Bases 1905 Bases
Molecular Weight591065.52 Da
Coding Sequence CP000629.1:815511..817415
NCBI ReferenceACM29314
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 382 379 N-terminal nucleotide/ATP binding domain PF00012
Linker 383 to 389 7 Linker region Manually identified
Substrate Binding Domain 390 to 599 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 247 to 274 28 Coiled coil region Manually identified
Coiled coil 511 to 531 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_AGRA2

Accession Number

HSP70_0022

Added on

2012-02-02

Updated On

2014-01-20