Help  Custom Search
 
putative chaperone of Aeromonas hydrophila subsp. hydrophila str. ATCC7966

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

putative chaperone

Synonymous Names

A0KQL8_AERHH, HSP70, Heat shock 70 kDa protein, Hypothetical chaperone protein YegD.

Taxon Information

Organism

Aeromonas hydrophila subsp. hydrophila str. ATCC7966

Organism ID

380703 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila subsp. hydrophila ATCC 7966

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MFIGFDYGTSNCAVAVMEQGSPRLLNLSGAHYLPSTLHAPHRDAIAGLLAEGLAPAQQSEYLKLRGPVVT RAQAVRRQMREEGLIDELSFGAAALERYLEEPDDGYYLKSPKSFLGAYGLKAPQIALFEDIVCAMMLHVR REAEQQLGAPIRRAVVGRPVNFQGLAGEESNRQAIAILSEAARLAGFEQVEFLYEPVAAGFEFEARLTED AVVLVVDIGGGTTDCSVLRMGPSHRDRLDRDGDLLGHSGQRIGGNDFDIRLTVEGMMPLLGMHETLKTGK PLPHPLFWDAAAINDVSAQSRFYSLDTARQLQDLQLDSQPGSKLGRLASLRAHKLSHQLVWRAEQGKIAL STQESNHQSLSELEKGLEAELTREQLANASALLLEKIGELMDEAIAAAGVQPDRVFITGGSARSPLIQAF IRQKLPQVPLEGGDDFGSVASGLARYAERLFGSGQPTPI

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTTTATCGGATTTGATTACGGTACCTCCAACTGTGCCGTCGCCGTGATGGAACAAGGCAGCCCCAGGCTGCTGAACCTGAGCGGTGC
CCACTACCTTCCCTCCACCCTGCACGCGCCCCACCGGGATGCCATTGCCGGCCTGCTGGCCGAAGGGCTGGCCCCCGCCCAGCAGAGCGA
GTACCTCAAGCTGCGCGGCCCCGTGGTCACCCGAGCCCAGGCGGTACGCCGCCAGATGCGCGAAGAGGGGCTGATCGACGAGCTCAGCTT
TGGCGCCGCGGCGCTGGAGCGCTATCTGGAAGAGCCGGACGACGGCTACTACCTCAAGTCGCCCAAATCCTTCCTCGGCGCCTACGGCCT
CAAGGCACCGCAGATCGCCCTGTTCGAAGACATCGTCTGCGCCATGATGCTGCACGTGCGGCGCGAGGCGGAGCAGCAGCTCGGCGCACC
GATCCGCCGGGCCGTGGTCGGCCGCCCGGTCAACTTCCAGGGGCTGGCGGGGGAAGAGAGCAACCGTCAGGCCATCGCCATCCTGAGCGA
AGCGGCCCGCCTCGCCGGGTTCGAGCAGGTGGAGTTTCTCTATGAGCCGGTGGCGGCCGGCTTCGAATTCGAGGCCCGCCTGACCGAGGA
TGCGGTGGTGCTGGTGGTGGACATCGGCGGCGGCACCACCGACTGCTCCGTGCTGCGGATGGGCCCGAGTCACCGCGACCGGCTCGATCG
CGACGGCGATCTGCTCGGCCACAGCGGCCAGCGCATCGGCGGCAACGACTTTGACATCCGGCTGACGGTGGAGGGCATGATGCCGCTGCT
CGGCATGCACGAGACCCTCAAGACCGGCAAGCCGCTGCCCCACCCGCTGTTCTGGGATGCCGCCGCCATCAACGACGTCAGCGCCCAGAG
CCGCTTCTACAGCCTGGATACCGCCCGCCAGCTGCAGGATCTGCAACTCGACAGCCAGCCCGGCAGCAAGCTGGGCCGCCTCGCCAGCCT
GCGCGCCCACAAGCTGAGCCACCAGCTGGTGTGGCGCGCCGAGCAGGGCAAGATCGCCCTCTCGACGCAGGAGTCCAATCACCAATCGCT
GAGCGAGCTGGAAAAAGGGCTGGAGGCGGAGCTGACCCGCGAACAGCTGGCCAATGCCTCTGCCCTGCTGCTGGAGAAAATTGGCGAGCT
GATGGATGAAGCCATCGCCGCCGCCGGCGTGCAGCCGGATCGGGTCTTCATCACCGGCGGCAGCGCCCGCTCCCCGCTGATCCAGGCCTT
CATCCGCCAGAAGTTGCCCCAGGTGCCGCTGGAAGGGGGCGATGACTTCGGCTCGGTCGCCTCCGGTCTGGCCCGTTACGCCGAGCGGCT
GTTTGGCAGCGGTCAACCCACCCCAATCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine23518 %
Guanine45133 %
Thyamine20916 %
Cytosine48536 %
A+T44433 %
G+C93668 %

Total Bases :   1380 bases

Microsatellites
SequencePosition LengthRepeats
AGCAGCAGC43033
AGAGAG50323
TGGTGGTGG64033
CGGCGGCGG65333
GCCGCCGCC86733
GCGCGC98923
GCGCGC102223
CTGCTGCTG114333
CGCCGCCGC118433

Microsatellite Map

ATGTTTATCGGATTTGATTACGGTACCTCCAACTGTGCCGTCGCCGTGATGGAACAAGGCAGCCCCAGGCTGCTGAACCTGAGCGGTGCC
CACTACCTTCCCTCCACCCTGCACGCGCCCCACCGGGATGCCATTGCCGGCCTGCTGGCCGAAGGGCTGGCCCCCGCCCAGCAGAGCGAG
TACCTCAAGCTGCGCGGCCCCGTGGTCACCCGAGCCCAGGCGGTACGCCGCCAGATGCGCGAAGAGGGGCTGATCGACGAGCTCAGCTTT
GGCGCCGCGGCGCTGGAGCGCTATCTGGAAGAGCCGGACGACGGCTACTACCTCAAGTCGCCCAAATCCTTCCTCGGCGCCTACGGCCTC
AAGGCACCGCAGATCGCCCTGTTCGAAGACATCGTCTGCGCCATGATGCTGCACGTGCGGCGCGAGGCGGAGCAGCAGCTCGGCGCACCG
ATCCGCCGGGCCGTGGTCGGCCGCCCGGTCAACTTCCAGGGGCTGGCGGGGGAAGAGAGCAACCGTCAGGCCATCGCCATCCTGAGCGAA
GCGGCCCGCCTCGCCGGGTTCGAGCAGGTGGAGTTTCTCTATGAGCCGGTGGCGGCCGGCTTCGAATTCGAGGCCCGCCTGACCGAGGAT
GCGGTGGTGCTGGTGGTGGACATCGGCGGCGGCACCACCGACTGCTCCGTGCTGCGGATGGGCCCGAGTCACCGCGACCGGCTCGATCGC
GACGGCGATCTGCTCGGCCACAGCGGCCAGCGCATCGGCGGCAACGACTTTGACATCCGGCTGACGGTGGAGGGCATGATGCCGCTGCTC
GGCATGCACGAGACCCTCAAGACCGGCAAGCCGCTGCCCCACCCGCTGTTCTGGGATGCCGCCGCCATCAACGACGTCAGCGCCCAGAGC
CGCTTCTACAGCCTGGATACCGCCCGCCAGCTGCAGGATCTGCAACTCGACAGCCAGCCCGGCAGCAAGCTGGGCCGCCTCGCCAGCCTG
CGCGCCCACAAGCTGAGCCACCAGCTGGTGTGGCGCGCCGAGCAGGGCAAGATCGCCCTCTCGACGCAGGAGTCCAATCACCAATCGCTG
AGCGAGCTGGAAAAAGGGCTGGAGGCGGAGCTGACCCGCGAACAGCTGGCCAATGCCTCTGCCCTGCTGCTGGAGAAAATTGGCGAGCTG
ATGGATGAAGCCATCGCCGCCGCCGGCGTGCAGCCGGATCGGGTCTTCATCACCGGCGGCAGCGCCCGCTCCCCGCTGATCCAGGCCTTC
ATCCGCCAGAAGTTGCCCCAGGTGCCGCTGGAAGGGGGCGATGACTTCGGCTCGGTCGCCTCCGGTCTGGCCCGTTACGCCGAGCGGCTG
TTTGGCAGCGGTCAACCCACCCCAATCTGA

Gene Information
Molecule Type genomic DNA
Bases 1380 Bases
Molecular Weight425846.2 Da
Coding Sequence CP000462.1:4593085..4594464
NCBI ReferenceABK37988
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
HSP70 124 to 267 144 Hsp70 protein family PF00012
HSP70 327 to 457 131 Hsp70 protein family PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_AEHY3

Accession Number

HSP70_0020

Added on

2012-02-02

Updated On

2014-01-20