Help  Custom Search
 
Fe-S protein assembly chaperone HscA of Aeromonas hydrophila subsp. hydrophila str. ATCC7966

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Fe-S protein assembly chaperone HscA

Synonymous Names

HSCA_AERHH, Heat shock protein 70, Heat shock 70 kDa protein, HSP70, HscA

Gene names

Gene Name

hscA

Gene Locus Tag

AHA_1751

Gene Identifier

4490281

Taxon Information

Organism

Aeromonas hydrophila subsp. hydrophila str. ATCC7966

Organism ID

380703 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila subsp. hydrophila ATCC 7966

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MALLQIAEPGQSAAPHQHKRAVGIDLGTTNSLVAAVRSGQADTLCDEQGRDLLPSVVHYQADTIRVGVDA KREAALDPHNTIVSAKRMMGKALADIDTRQQPYQFVAADNGMPQLQTRQGLVNPVQVSAEILKKLAERGA AALGGDLDGVVITVPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGT FDISILRLHRGVFEVMATGGDSALGGDDFDHLLADWLKEQAGLTGELDARLQRELLDVAAAVKHGLTDAD AVPCTFAGWQGSVTRSQFDELIQPLVKRTLLACRRALRDAGLEQEEVLEVVMVGGSTRVPLVRELVGEFF QRPPLTSIDPDKVVAIGAAIQADILVGNKPDAEMLLLDVIPLSLGLETMGGLAEKVIPRNTTIPVARAQE FTTFKDGQTAMAIHVVQGERELVADCRSLARFTLTGIPPMVAGAAHIRVTFQVDADGLLSVSAMEKSSGV QAEIQVKPSYGLGEDDILNMLSASIANAQQDMDARMLAEQQVEADRVVESLNAALAADGEALLSPAERAE LDAAIAHLLTMRSTGTTNQIKEAIEAADAASGEFAARRMDASIRKVLTGQNVNKV

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCATTACTGCAAATCGCCGAGCCCGGCCAGAGCGCCGCACCTCATCAGCACAAACGTGCCGTTGGCATCGATCTTGGCACTACCAA
CTCGCTGGTCGCCGCCGTGCGTAGCGGTCAGGCCGATACCCTCTGCGACGAGCAGGGGCGTGATCTGCTGCCCTCCGTCGTGCATTACCA
GGCTGATACCATCCGGGTCGGCGTCGATGCCAAGCGCGAGGCCGCCCTCGACCCGCACAACACCATCGTTTCCGCCAAGCGGATGATGGG
CAAGGCGCTGGCCGACATCGATACCCGCCAGCAGCCCTATCAATTCGTGGCAGCCGACAACGGCATGCCGCAACTGCAGACCCGTCAAGG
GCTGGTCAACCCGGTTCAGGTCTCGGCCGAAATACTCAAAAAGCTGGCCGAGCGGGGCGCTGCCGCCCTCGGTGGCGATCTCGACGGCGT
GGTCATCACAGTGCCCGCCTATTTCGATGACGCCCAGCGCCAGGGCACCAAGGATGCGGCCCGACTGGCCGGTCTGCACGTGCTGCGCCT
GCTCAACGAGCCGACTGCGGCCGCGATTGCCTATGGCCTCGACTCCGGTCAGGAAGGGGTGATCGCTGTTTATGACCTGGGTGGCGGCAC
CTTCGATATCTCCATCCTGCGTCTACATCGCGGGGTGTTTGAAGTGATGGCCACCGGCGGCGATTCGGCCCTCGGCGGCGATGATTTCGA
TCACCTGCTGGCAGACTGGTTGAAAGAACAAGCCGGTTTGACTGGCGAGCTGGATGCCCGTCTGCAGCGCGAGCTGCTGGATGTGGCCGC
CGCGGTCAAACACGGTCTGACGGACGCCGACGCCGTTCCCTGCACCTTTGCCGGCTGGCAGGGCTCTGTCACCCGCAGTCAGTTTGACGA
GCTGATCCAGCCGCTGGTCAAGCGCACCCTGCTGGCCTGCCGCCGCGCCCTGCGCGATGCGGGGCTCGAGCAGGAAGAAGTGCTGGAAGT
GGTGATGGTCGGCGGTTCGACCCGGGTGCCGCTGGTGCGCGAGCTGGTGGGTGAGTTCTTCCAGCGTCCCCCCTTGACCAGCATCGACCC
CGACAAGGTGGTGGCCATCGGTGCCGCCATCCAGGCCGACATCCTGGTGGGCAACAAGCCTGACGCCGAGATGCTGCTGCTGGACGTGAT
CCCGCTCTCTCTGGGTCTTGAGACCATGGGCGGTCTCGCCGAGAAGGTGATCCCGCGCAATACCACCATTCCGGTGGCCCGCGCCCAGGA
GTTCACCACCTTCAAGGATGGCCAGACCGCGATGGCGATCCACGTGGTGCAGGGCGAGCGCGAGCTGGTGGCCGATTGCCGATCCTTGGC
CCGCTTCACCCTGACCGGCATTCCGCCCATGGTGGCCGGTGCCGCCCACATTCGCGTCACCTTCCAGGTGGATGCGGACGGTCTGCTGTC
GGTCAGTGCCATGGAGAAATCCTCCGGCGTGCAGGCCGAGATCCAGGTCAAGCCCTCCTATGGACTGGGTGAGGATGACATCCTCAACAT
GCTGAGCGCCTCCATCGCCAATGCCCAGCAGGACATGGATGCCCGCATGCTGGCGGAGCAGCAGGTCGAGGCCGACCGGGTGGTCGAGAG
TCTCAACGCCGCGCTGGCTGCCGATGGCGAGGCTTTATTGAGCCCCGCCGAGCGGGCCGAGCTGGATGCCGCCATCGCCCATCTGCTGAC
CATGCGCAGCACGGGCACCACCAACCAGATCAAAGAGGCCATCGAGGCGGCGGATGCTGCCAGTGGCGAATTTGCAGCCCGCCGGATGGA
TGCCTCCATCCGCAAGGTGCTGACCGGACAAAACGTCAACAAGGTGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine32418 %
Guanine59433 %
Thyamine32318 %
Cytosine60733 %
A+T64736 %
G+C120165 %

Total Bases :   1848 bases

Microsatellites
SequencePosition LengthRepeats
CCCCCC105623
TGCTGCTGC115033
CTCTCTCT117324

Microsatellite Map

ATGGCATTACTGCAAATCGCCGAGCCCGGCCAGAGCGCCGCACCTCATCAGCACAAACGTGCCGTTGGCATCGATCTTGGCACTACCAAC
TCGCTGGTCGCCGCCGTGCGTAGCGGTCAGGCCGATACCCTCTGCGACGAGCAGGGGCGTGATCTGCTGCCCTCCGTCGTGCATTACCAG
GCTGATACCATCCGGGTCGGCGTCGATGCCAAGCGCGAGGCCGCCCTCGACCCGCACAACACCATCGTTTCCGCCAAGCGGATGATGGGC
AAGGCGCTGGCCGACATCGATACCCGCCAGCAGCCCTATCAATTCGTGGCAGCCGACAACGGCATGCCGCAACTGCAGACCCGTCAAGGG
CTGGTCAACCCGGTTCAGGTCTCGGCCGAAATACTCAAAAAGCTGGCCGAGCGGGGCGCTGCCGCCCTCGGTGGCGATCTCGACGGCGTG
GTCATCACAGTGCCCGCCTATTTCGATGACGCCCAGCGCCAGGGCACCAAGGATGCGGCCCGACTGGCCGGTCTGCACGTGCTGCGCCTG
CTCAACGAGCCGACTGCGGCCGCGATTGCCTATGGCCTCGACTCCGGTCAGGAAGGGGTGATCGCTGTTTATGACCTGGGTGGCGGCACC
TTCGATATCTCCATCCTGCGTCTACATCGCGGGGTGTTTGAAGTGATGGCCACCGGCGGCGATTCGGCCCTCGGCGGCGATGATTTCGAT
CACCTGCTGGCAGACTGGTTGAAAGAACAAGCCGGTTTGACTGGCGAGCTGGATGCCCGTCTGCAGCGCGAGCTGCTGGATGTGGCCGCC
GCGGTCAAACACGGTCTGACGGACGCCGACGCCGTTCCCTGCACCTTTGCCGGCTGGCAGGGCTCTGTCACCCGCAGTCAGTTTGACGAG
CTGATCCAGCCGCTGGTCAAGCGCACCCTGCTGGCCTGCCGCCGCGCCCTGCGCGATGCGGGGCTCGAGCAGGAAGAAGTGCTGGAAGTG
GTGATGGTCGGCGGTTCGACCCGGGTGCCGCTGGTGCGCGAGCTGGTGGGTGAGTTCTTCCAGCGTCCCCCCTTGACCAGCATCGACCCC
GACAAGGTGGTGGCCATCGGTGCCGCCATCCAGGCCGACATCCTGGTGGGCAACAAGCCTGACGCCGAGATGCTGCTGCTGGACGTGATC
CCGCTCTCTCTGGGTCTTGAGACCATGGGCGGTCTCGCCGAGAAGGTGATCCCGCGCAATACCACCATTCCGGTGGCCCGCGCCCAGGAG
TTCACCACCTTCAAGGATGGCCAGACCGCGATGGCGATCCACGTGGTGCAGGGCGAGCGCGAGCTGGTGGCCGATTGCCGATCCTTGGCC
CGCTTCACCCTGACCGGCATTCCGCCCATGGTGGCCGGTGCCGCCCACATTCGCGTCACCTTCCAGGTGGATGCGGACGGTCTGCTGTCG
GTCAGTGCCATGGAGAAATCCTCCGGCGTGCAGGCCGAGATCCAGGTCAAGCCCTCCTATGGACTGGGTGAGGATGACATCCTCAACATG
CTGAGCGCCTCCATCGCCAATGCCCAGCAGGACATGGATGCCCGCATGCTGGCGGAGCAGCAGGTCGAGGCCGACCGGGTGGTCGAGAGT
CTCAACGCCGCGCTGGCTGCCGATGGCGAGGCTTTATTGAGCCCCGCCGAGCGGGCCGAGCTGGATGCCGCCATCGCCCATCTGCTGACC
ATGCGCAGCACGGGCACCACCAACCAGATCAAAGAGGCCATCGAGGCGGCGGATGCTGCCAGTGGCGAATTTGCAGCCCGCCGGATGGAT
GCCTCCATCCGCAAGGTGCTGACCGGACAAAACGTCAACAAGGTGTAA

Gene Information
Molecule Type genomic DNA
Bases 1848 Bases
Molecular Weight570757.68 Da
Coding Sequence CP000462.1:1912703..1914550
NCBI ReferenceABK37680
Notesidentified by match to protein family HMM PF00012;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 21 to 382 362 N-terminal nucleotide/ATP binding domain PF00012
Linker 383 to 389 7 Linker region Manually identified
Substrate Binding Domain 390 to 600 211 C-terminal substrate/peptide binding domain PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_AEHY2

Accession Number

HSP70_0019

Added on

2012-02-02

Updated On

2014-01-20