Help  Custom Search
 
chaperone protein DnaK of Aeromonas hydrophila subsp. hydrophila str. ATCC7966

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone protein DnaK

Synonymous Names

DNAK_AERHH, Heat shock protein 70, Heat shock 70 kDa protein, HSP70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

AHA_2983

Gene Identifier

4488919

Taxon Information

Organism

Aeromonas hydrophila subsp. hydrophila str. ATCC7966

Organism ID

380703 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila subsp. hydrophila ATCC 7966

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MGKIIGIDLGTTNSCVAILDGDHARVIENAEGDRTTPSIIAYADDGEILVGQPAKRQAITNPKNTLFAIK RLIGRRFEDDEVQRDLEIMPYAIAKADNGDAWVEVKGKKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVI TVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAAFAYGVNKVKGERKVAVYDLGGGTFDISIIEIDEV EGETTFEVLATNGNTHLGGEDFDNRVINYLVEEFKREQGIDLRKDQLALQRLKDAAEKAKIELSSAQQTD VNLPYITADATGPKHMNIKVTRAKLESLVEDMVKDSLEPVRVALKDSGLAVGEIDDVILVGGQTRMPMVQ KAVADFFGKEPRKDVNPDEAVAMGAAIQGAVLSGDKTDVLLLDVTPLSLGIETMGSVMTALIEKNTTIPT KKSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLEGIRPAPRGLPQIEVTFDIDANGILHVSAKD KETNKEQKITIQASSGLSDDEIERMVREAEANAAEDKKFEELVQTRNQADGLVHSVRKQITEAGEALPAD DKTKIEAALSELESAIKGDDKAAIEAKQQALLEASQKLMEIAQQQAQAQGAAGADAGQSSSSAKADDDVV DAEFEEVKDDKK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGGTAAAATCATCGGTATTGACCTGGGTACTACCAACTCCTGCGTCGCTATTCTGGATGGCGACCATGCTCGCGTGATCGAGAACGC
GGAAGGCGACCGTACTACTCCGTCCATCATTGCCTATGCCGATGACGGCGAAATCCTGGTTGGTCAGCCGGCCAAGCGCCAAGCCATCAC
CAACCCGAAGAACACGCTGTTCGCCATCAAGCGTCTGATCGGCCGTCGTTTCGAAGATGACGAAGTACAGCGCGATCTGGAGATCATGCC
GTACGCCATCGCCAAGGCCGACAACGGTGACGCCTGGGTAGAAGTCAAAGGCAAGAAAATGGCACCGCCGCAGATCTCTGCCGAAGTGCT
GAAGAAAATGAAGAAGACCGCCGAAGATTATCTGGGCGAGCCGGTGACCGAAGCCGTCATCACAGTGCCGGCCTACTTCAACGATGCCCA
GCGTCAGGCTACCAAGGATGCCGGTCGTATCGCCGGTCTGGATGTAAAACGCATCATCAACGAACCGACTGCCGCGGCTTTCGCCTACGG
CGTCAACAAGGTCAAGGGCGAGCGCAAGGTTGCCGTCTATGACCTGGGTGGCGGTACTTTCGATATCTCCATCATCGAGATCGACGAAGT
CGAAGGCGAGACCACCTTCGAAGTACTGGCGACCAACGGTAACACCCACTTGGGTGGCGAAGACTTCGACAACCGCGTCATCAACTACCT
GGTTGAAGAGTTTAAGCGCGAGCAGGGTATCGACCTGCGCAAGGATCAGCTGGCTCTGCAACGTCTGAAAGACGCGGCTGAAAAAGCCAA
GATCGAGCTCTCTTCCGCCCAGCAGACCGACGTCAACCTGCCGTACATCACTGCAGATGCCACCGGTCCGAAGCACATGAACATCAAGGT
GACCCGCGCCAAGCTGGAATCCCTGGTGGAAGACATGGTGAAAGACTCCCTGGAGCCGGTCCGTGTCGCTCTGAAAGACTCCGGTCTGGC
CGTTGGCGAGATCGACGACGTCATCCTGGTAGGCGGTCAGACCCGCATGCCGATGGTGCAGAAGGCCGTTGCCGACTTCTTCGGCAAAGA
GCCGCGCAAAGACGTCAACCCGGACGAAGCCGTGGCCATGGGTGCTGCCATTCAGGGTGCCGTACTGTCCGGTGACAAGACCGACGTACT
GCTGCTGGACGTGACCCCGCTCTCCCTGGGTATCGAAACCATGGGCAGCGTGATGACTGCGTTGATCGAGAAGAACACCACCATTCCGAC
CAAGAAGTCCCAGGTGTTCTCCACTGCCGAAGACAACCAGTCTGCCGTGACCATTCACGTGCTGCAGGGTGAGCGCAAGCGCGCCAGCGA
CAACAAGTCTCTGGGCCAGTTCAACCTGGAAGGCATCCGTCCGGCACCGCGTGGTCTGCCGCAGATCGAAGTGACCTTCGACATCGACGC
CAACGGCATCCTGCACGTCTCCGCCAAAGACAAGGAGACCAACAAGGAGCAGAAGATCACCATCCAGGCCTCCTCTGGTCTGTCTGATGA
CGAGATCGAACGCATGGTACGCGAAGCCGAAGCCAACGCGGCCGAGGACAAGAAGTTCGAAGAGCTGGTGCAGACCCGCAACCAGGCTGA
TGGTCTGGTCCACTCTGTCCGCAAGCAGATCACCGAAGCCGGTGAAGCCCTGCCTGCCGACGACAAGACCAAGATCGAAGCCGCGCTGAG
CGAGCTGGAAAGCGCCATCAAGGGTGACGACAAGGCTGCCATCGAAGCCAAACAGCAGGCACTGCTGGAAGCGTCCCAGAAGCTGATGGA
AATTGCCCAGCAGCAGGCTCAGGCGCAAGGTGCCGCCGGTGCTGATGCCGGTCAGTCCTCTTCTTCCGCCAAGGCTGACGACGACGTGGT
CGACGCCGAGTTCGAAGAAGTGAAAGACGACAAGAAGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine47725 %
Guanine55929 %
Thyamine32117 %
Cytosine57230 %
A+T79842 %
G+C113159 %

Total Bases :   1929 bases

Microsatellites
SequencePosition LengthRepeats
CTCTCT81623
CTGCTGCTG116733
GCGCGC133723
CAGCAGCAG180633
GACGACGAC187533

Microsatellite Map

ATGGGTAAAATCATCGGTATTGACCTGGGTACTACCAACTCCTGCGTCGCTATTCTGGATGGCGACCATGCTCGCGTGATCGAGAACGCG
GAAGGCGACCGTACTACTCCGTCCATCATTGCCTATGCCGATGACGGCGAAATCCTGGTTGGTCAGCCGGCCAAGCGCCAAGCCATCACC
AACCCGAAGAACACGCTGTTCGCCATCAAGCGTCTGATCGGCCGTCGTTTCGAAGATGACGAAGTACAGCGCGATCTGGAGATCATGCCG
TACGCCATCGCCAAGGCCGACAACGGTGACGCCTGGGTAGAAGTCAAAGGCAAGAAAATGGCACCGCCGCAGATCTCTGCCGAAGTGCTG
AAGAAAATGAAGAAGACCGCCGAAGATTATCTGGGCGAGCCGGTGACCGAAGCCGTCATCACAGTGCCGGCCTACTTCAACGATGCCCAG
CGTCAGGCTACCAAGGATGCCGGTCGTATCGCCGGTCTGGATGTAAAACGCATCATCAACGAACCGACTGCCGCGGCTTTCGCCTACGGC
GTCAACAAGGTCAAGGGCGAGCGCAAGGTTGCCGTCTATGACCTGGGTGGCGGTACTTTCGATATCTCCATCATCGAGATCGACGAAGTC
GAAGGCGAGACCACCTTCGAAGTACTGGCGACCAACGGTAACACCCACTTGGGTGGCGAAGACTTCGACAACCGCGTCATCAACTACCTG
GTTGAAGAGTTTAAGCGCGAGCAGGGTATCGACCTGCGCAAGGATCAGCTGGCTCTGCAACGTCTGAAAGACGCGGCTGAAAAAGCCAAG
ATCGAGCTCTCTTCCGCCCAGCAGACCGACGTCAACCTGCCGTACATCACTGCAGATGCCACCGGTCCGAAGCACATGAACATCAAGGTG
ACCCGCGCCAAGCTGGAATCCCTGGTGGAAGACATGGTGAAAGACTCCCTGGAGCCGGTCCGTGTCGCTCTGAAAGACTCCGGTCTGGCC
GTTGGCGAGATCGACGACGTCATCCTGGTAGGCGGTCAGACCCGCATGCCGATGGTGCAGAAGGCCGTTGCCGACTTCTTCGGCAAAGAG
CCGCGCAAAGACGTCAACCCGGACGAAGCCGTGGCCATGGGTGCTGCCATTCAGGGTGCCGTACTGTCCGGTGACAAGACCGACGTACTG
CTGCTGGACGTGACCCCGCTCTCCCTGGGTATCGAAACCATGGGCAGCGTGATGACTGCGTTGATCGAGAAGAACACCACCATTCCGACC
AAGAAGTCCCAGGTGTTCTCCACTGCCGAAGACAACCAGTCTGCCGTGACCATTCACGTGCTGCAGGGTGAGCGCAAGCGCGCCAGCGAC
AACAAGTCTCTGGGCCAGTTCAACCTGGAAGGCATCCGTCCGGCACCGCGTGGTCTGCCGCAGATCGAAGTGACCTTCGACATCGACGCC
AACGGCATCCTGCACGTCTCCGCCAAAGACAAGGAGACCAACAAGGAGCAGAAGATCACCATCCAGGCCTCCTCTGGTCTGTCTGATGAC
GAGATCGAACGCATGGTACGCGAAGCCGAAGCCAACGCGGCCGAGGACAAGAAGTTCGAAGAGCTGGTGCAGACCCGCAACCAGGCTGAT
GGTCTGGTCCACTCTGTCCGCAAGCAGATCACCGAAGCCGGTGAAGCCCTGCCTGCCGACGACAAGACCAAGATCGAAGCCGCGCTGAGC
GAGCTGGAAAGCGCCATCAAGGGTGACGACAAGGCTGCCATCGAAGCCAAACAGCAGGCACTGCTGGAAGCGTCCCAGAAGCTGATGGAA
ATTGCCCAGCAGCAGGCTCAGGCGCAAGGTGCCGCCGGTGCTGATGCCGGTCAGTCCTCTTCTTCCGCCAAGGCTGACGACGACGTGGTC
GACGCCGAGTTCGAAGAAGTGAAAGACGACAAGAAGTAA

Gene Information
Molecule Type genomic DNA
Bases 1929 Bases
Molecular Weight596426.76 Da
Coding Sequence complement(CP000462.1:3357741..3359669)
NCBI ReferenceABK38561
Notesidentified by match to protein family HMM PF00012;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 387 384 N-terminal nucleotide/ATP binding domain PF00012
Linker 388 to 394 7 Linker region Manually identified
Substrate Binding Domain 395 to 604 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 252 to 279 28 Coiled coil region Manually identified
Coiled coil 584 to 604 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_AEHY1

Accession Number

HSP70_0018

Added on

2012-02-02

Updated On

2014-01-20