Help  Custom Search
 
chaperone protein HscA of Actinobacillus succinogenes str. 130Z

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone protein HscA

Synonymous Names

HSCA_ACTSZ, Heat shock protein 70, Heat shock 70 kDa protein, HSP70, HscA

Gene names

Gene Name

hscA

Gene Locus Tag

Asuc_0868

Gene Identifier

5348467

Taxon Information

Organism

Actinobacillus succinogenes str. 130Z

Organism ID

339671 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus succinogenes 130Z

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MALLQIAEPGQSAAPHQHKLAIGIDLGTTNSLVATVRNGQAEILLDEKERPLTPSIVHYGDNVTVGYDAG ELASRDPQNTIISVKRLIGRSLNDVQARYPNLPYRFVRSENGLPLLGTAQGNVSPIEVSGEILKKLTALA QHRLNGELLGVVITVPAYFDDAQRQSTKDAAKLAGLNVLRLLNEPTAAAIAYGLDSGREGVIAVYDLGGG TFDISILRLSRGVFEVLATGGDTALGGDDFDHLIADWISEKSGIQPQDDQQKRLLIELAARTKIALTDKP QVSLSYQGWQGEMQREEFNGLISGLVKRSLMACRRALKDAGIGQSEVQEVVMVGGSTRVPFVRDQVGEFF QRRPLTSIDPDKVVALGAAIQADILVGNKPDNEMLLLDVIPLSLGIETMGGLVEKIIPRNTTIPVARAQE FTTFKDGQTAMSVHVVQGERELVGDCRSLARFTLRGIPPMAAGAAHIRVTYQVDADGLLSVTAMEKSTGV QSSIQVKPSYGLTDDEITQMLKASMENAKEDIGARMLAEQRVEARRVIEAVLSALLDDQDLLNDEELSTV KNALVSLDNLQQGTDTQAIKAGIKALDAATQEFAARRMDKSIRRALSGQSVDSL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCATTACTTCAGATTGCCGAGCCGGGACAAAGTGCGGCTCCGCATCAGCATAAATTAGCAATCGGTATCGATCTCGGTACTACTAA
CAGTCTGGTGGCAACGGTACGTAACGGGCAAGCGGAAATTTTACTCGATGAAAAAGAGCGACCGCTAACCCCTTCTATCGTGCATTACGG
TGATAACGTAACGGTAGGTTATGACGCGGGCGAATTAGCGAGTCGGGATCCGCAGAATACGATTATTTCGGTAAAACGCTTGATAGGGCG
CAGCCTGAACGACGTGCAAGCGCGTTACCCAAATTTACCGTATCGGTTTGTGCGGAGCGAAAACGGACTGCCTTTGCTGGGAACAGCGCA
AGGAAATGTCAGTCCGATTGAAGTTTCCGGTGAAATCCTGAAAAAACTGACCGCACTTGCGCAGCATCGTTTAAACGGCGAATTATTGGG
TGTCGTGATTACGGTGCCGGCGTATTTTGATGACGCACAACGCCAAAGCACGAAAGATGCCGCCAAGTTAGCGGGATTAAACGTATTGCG
TCTGTTAAACGAACCGACTGCGGCAGCCATTGCTTATGGTCTCGACAGCGGGCGTGAAGGTGTGATTGCCGTCTATGATTTAGGCGGCGG
TACTTTTGATATTTCGATTCTGCGCTTATCCCGAGGTGTATTTGAAGTACTGGCGACAGGCGGAGATACCGCACTGGGCGGTGATGATTT
TGACCATTTGATCGCAGATTGGATCAGCGAAAAATCCGGTATTCAACCGCAGGACGATCAGCAAAAACGGCTGTTGATTGAATTGGCGGC
ACGTACCAAAATCGCATTAACGGACAAACCGCAAGTCAGCCTTTCATACCAAGGTTGGCAGGGCGAAATGCAACGCGAGGAGTTTAACGG
ACTAATTTCGGGTTTGGTAAAACGCTCGTTAATGGCTTGTCGTCGCGCCTTGAAAGATGCGGGAATCGGTCAGTCCGAGGTACAGGAAGT
CGTAATGGTGGGCGGTTCCACCCGTGTTCCTTTCGTACGCGACCAAGTGGGCGAGTTTTTTCAACGTCGACCATTAACCTCTATCGATCC
TGATAAAGTTGTAGCCTTAGGCGCGGCGATTCAGGCGGATATTCTGGTAGGCAATAAACCCGACAACGAAATGTTGCTGCTGGATGTTAT
TCCATTATCTCTCGGAATTGAAACCATGGGCGGTTTGGTGGAAAAAATCATTCCCCGCAATACGACTATTCCGGTGGCGCGGGCGCAGGA
ATTTACTACCTTTAAAGACGGACAAACCGCTATGTCGGTGCACGTGGTGCAGGGTGAACGCGAATTGGTGGGCGATTGTCGTTCTTTAGC
GCGTTTCACCTTGCGCGGCATTCCACCGATGGCGGCGGGTGCGGCGCATATTCGCGTGACTTATCAGGTGGATGCGGACGGCTTGTTAAG
CGTCACGGCTATGGAAAAATCCACCGGCGTACAATCCAGTATTCAAGTGAAACCTTCTTATGGATTAACCGATGATGAAATCACCCAAAT
GCTGAAAGCGTCGATGGAAAATGCCAAAGAAGATATTGGTGCCCGTATGCTGGCGGAACAGCGGGTTGAAGCCCGTCGAGTGATTGAAGC
CGTATTATCCGCTTTGCTGGACGATCAGGATTTACTGAATGACGAGGAATTAAGTACGGTCAAAAATGCCTTGGTTTCGCTGGATAATTT
ACAGCAGGGAACAGACACTCAGGCCATCAAAGCAGGCATTAAAGCGCTGGATGCGGCAACGCAGGAATTCGCTGCCCGCCGTATGGACAA
ATCCATCCGACGCGCCTTGTCCGGCCAGTCGGTAGACAGTTTATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine47426 %
Guanine51829 %
Thyamine43924 %
Cytosine41423 %
A+T91350 %
G+C93251 %

Total Bases :   1845 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA39923
TTTTTT104423
TCTCTC117623
AAAAAA121023

Microsatellite Map

ATGGCATTACTTCAGATTGCCGAGCCGGGACAAAGTGCGGCTCCGCATCAGCATAAATTAGCAATCGGTATCGATCTCGGTACTACTAAC
AGTCTGGTGGCAACGGTACGTAACGGGCAAGCGGAAATTTTACTCGATGAAAAAGAGCGACCGCTAACCCCTTCTATCGTGCATTACGGT
GATAACGTAACGGTAGGTTATGACGCGGGCGAATTAGCGAGTCGGGATCCGCAGAATACGATTATTTCGGTAAAACGCTTGATAGGGCGC
AGCCTGAACGACGTGCAAGCGCGTTACCCAAATTTACCGTATCGGTTTGTGCGGAGCGAAAACGGACTGCCTTTGCTGGGAACAGCGCAA
GGAAATGTCAGTCCGATTGAAGTTTCCGGTGAAATCCTGAAAAAACTGACCGCACTTGCGCAGCATCGTTTAAACGGCGAATTATTGGGT
GTCGTGATTACGGTGCCGGCGTATTTTGATGACGCACAACGCCAAAGCACGAAAGATGCCGCCAAGTTAGCGGGATTAAACGTATTGCGT
CTGTTAAACGAACCGACTGCGGCAGCCATTGCTTATGGTCTCGACAGCGGGCGTGAAGGTGTGATTGCCGTCTATGATTTAGGCGGCGGT
ACTTTTGATATTTCGATTCTGCGCTTATCCCGAGGTGTATTTGAAGTACTGGCGACAGGCGGAGATACCGCACTGGGCGGTGATGATTTT
GACCATTTGATCGCAGATTGGATCAGCGAAAAATCCGGTATTCAACCGCAGGACGATCAGCAAAAACGGCTGTTGATTGAATTGGCGGCA
CGTACCAAAATCGCATTAACGGACAAACCGCAAGTCAGCCTTTCATACCAAGGTTGGCAGGGCGAAATGCAACGCGAGGAGTTTAACGGA
CTAATTTCGGGTTTGGTAAAACGCTCGTTAATGGCTTGTCGTCGCGCCTTGAAAGATGCGGGAATCGGTCAGTCCGAGGTACAGGAAGTC
GTAATGGTGGGCGGTTCCACCCGTGTTCCTTTCGTACGCGACCAAGTGGGCGAGTTTTTTCAACGTCGACCATTAACCTCTATCGATCCT
GATAAAGTTGTAGCCTTAGGCGCGGCGATTCAGGCGGATATTCTGGTAGGCAATAAACCCGACAACGAAATGTTGCTGCTGGATGTTATT
CCATTATCTCTCGGAATTGAAACCATGGGCGGTTTGGTGGAAAAAATCATTCCCCGCAATACGACTATTCCGGTGGCGCGGGCGCAGGAA
TTTACTACCTTTAAAGACGGACAAACCGCTATGTCGGTGCACGTGGTGCAGGGTGAACGCGAATTGGTGGGCGATTGTCGTTCTTTAGCG
CGTTTCACCTTGCGCGGCATTCCACCGATGGCGGCGGGTGCGGCGCATATTCGCGTGACTTATCAGGTGGATGCGGACGGCTTGTTAAGC
GTCACGGCTATGGAAAAATCCACCGGCGTACAATCCAGTATTCAAGTGAAACCTTCTTATGGATTAACCGATGATGAAATCACCCAAATG
CTGAAAGCGTCGATGGAAAATGCCAAAGAAGATATTGGTGCCCGTATGCTGGCGGAACAGCGGGTTGAAGCCCGTCGAGTGATTGAAGCC
GTATTATCCGCTTTGCTGGACGATCAGGATTTACTGAATGACGAGGAATTAAGTACGGTCAAAAATGCCTTGGTTTCGCTGGATAATTTA
CAGCAGGGAACAGACACTCAGGCCATCAAAGCAGGCATTAAAGCGCTGGATGCGGCAACGCAGGAATTCGCTGCCCGCCGTATGGACAAA
TCCATCCGACGCGCCTTGTCCGGCCAGTCGGTAGACAGTTTATAA

Gene Information
Molecule Type genomic DNA
Bases 1845 Bases
Molecular Weight572194.68 Da
Coding Sequence CP000746.1:931194..933038
NCBI ReferenceABR74238
NotesTIGRFAM: Fe-S protein assembly chaperone HscA; PFAM:

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 21 to 382 362 N-terminal nucleotide/ATP binding domain PF00012
Linker 383 to 389 7 Linker region Manually identified
Substrate Binding Domain 390 to 599 210 C-terminal substrate/peptide binding domain PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACSU2

Accession Number

HSP70_0017

Added on

2012-02-02

Updated On

2014-01-20