Help  Custom Search
 
chaperone protein DnaK of Actinobacillus succinogenes str. 130Z

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone protein DnaK

Synonymous Names

DNAK_ACTSZ, Heat shock protein 70, Heat shock 70 kDa protein, HSP70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

Asuc_1092

Gene Identifier

5347571

Taxon Information

Organism

Actinobacillus succinogenes str. 130Z

Organism ID

339671 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus succinogenes 130Z

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MGKIIGIDLGTTNSCVAVMDGDKPRVIENAEGDRTTPSIIAYTNDNETLVGQPAKRQAVTNPKNTLFAIK RLIGRRFEDNEVQRDVDIMPFKIIRADNGDAWVDVKGDKLAPPQVSAEVLKKMKKTAEDFLGETVTEAVI TVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKGKGNQTIAVYDLGGGTFDLSIIEIDEV GGEKTFEVLATNGDTHLGGEDFDNRVINYLVDEFKKEQGVDLRNDPLAMQRLKEAGEKAKIELSSAQQTD VNLPYITADATGPKHLNIKLTRAKLEALVEDLVARSMEPVKVALKDAGLSVSEIDDVILVGGQTRMPLVQ QKVAEFFGKEPRKDVNPDEAVAVGAAVQGGVLSGNVTDVLLLDVTPLSLGIETMGGVMTTLIEKNTTIPT KKSQVFSTAEDNQSAVTIHVLQGERKQASANKSLGQFNLEGINPAPRGMPQIEVTFDIDADGIIHVSAKD KGTGKEQQITIKASSGLSDEEIQQMVRDAEANADADRKFEELVQARNQADALVHATRKQLTEAGDKLSAD DKAPIEKAVSELEDAVKGDDKDAIEAKSQALIQVSEKLMQAAQQQAQANTQGQQSQGGNDDGVVDAEFEE VKDNK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGGTAAAATTATCGGTATTGACTTAGGTACAACAAATTCTTGTGTTGCGGTGATGGACGGTGACAAACCGCGCGTAATTGAAAATGC
AGAGGGAGATCGTACAACCCCTTCAATTATTGCATACACAAATGATAACGAAACATTAGTCGGTCAACCTGCAAAACGTCAAGCGGTAAC
CAATCCAAAAAATACCTTATTCGCAATCAAGCGTTTAATCGGTCGTCGTTTTGAAGACAATGAAGTACAACGCGACGTTGACATTATGCC
GTTCAAAATCATCAGAGCGGATAACGGCGACGCATGGGTTGATGTGAAAGGTGATAAACTGGCGCCACCGCAAGTTTCTGCCGAAGTATT
GAAAAAAATGAAAAAAACGGCGGAAGATTTCTTGGGTGAAACGGTTACCGAAGCGGTAATCACCGTTCCTGCATACTTTAACGACGCACA
ACGCCAGGCAACCAAGGATGCCGGTCGTATTGCCGGTTTAGACGTTAAACGTATTATTAACGAACCGACTGCCGCCGCATTGGCTTACGG
GCTGGATAAAGGCAAGGGCAACCAAACTATTGCGGTTTACGACTTAGGCGGCGGTACCTTCGACTTATCTATCATCGAAATTGATGAAGT
CGGCGGCGAAAAAACCTTCGAAGTACTGGCAACTAACGGTGATACTCACTTAGGCGGCGAAGACTTCGATAACCGTGTAATCAACTATTT
GGTTGACGAATTCAAAAAAGAACAAGGCGTAGATTTACGTAACGATCCGTTAGCAATGCAGCGTTTGAAAGAAGCGGGTGAAAAAGCCAA
AATCGAATTGTCTTCCGCACAACAAACTGATGTGAACTTACCTTACATCACAGCGGATGCGACTGGTCCTAAACACTTAAACATTAAATT
AACCCGTGCAAAATTGGAAGCGTTAGTGGAAGATTTGGTGGCTCGTTCGATGGAACCTGTGAAAGTCGCACTGAAAGACGCCGGCTTAAG
CGTTTCTGAAATCGACGACGTCATTTTGGTGGGCGGTCAAACCCGTATGCCGTTGGTGCAACAAAAAGTGGCCGAATTCTTCGGTAAAGA
ACCGCGTAAAGACGTGAATCCGGATGAAGCGGTTGCAGTAGGTGCGGCAGTTCAAGGCGGCGTGTTATCCGGTAATGTAACCGACGTATT
ATTGTTAGACGTTACACCGTTATCATTAGGTATCGAAACCATGGGTGGCGTAATGACAACTCTGATTGAGAAAAACACCACGATTCCGAC
TAAAAAATCACAAGTGTTCTCAACGGCGGAAGATAACCAAAGTGCGGTGACTATTCATGTCTTACAAGGTGAACGCAAACAAGCCAGTGC
CAACAAATCGTTGGGTCAATTCAACCTTGAAGGTATTAACCCGGCTCCGCGCGGTATGCCGCAAATTGAAGTGACTTTCGATATTGATGC
GGACGGTATTATCCACGTTTCGGCGAAAGATAAAGGTACCGGTAAAGAACAACAAATTACGATTAAAGCTTCTTCAGGTTTAAGCGATGA
AGAAATTCAACAAATGGTACGTGATGCGGAAGCGAACGCCGATGCGGATCGTAAATTTGAAGAATTGGTTCAGGCGCGTAACCAAGCGGA
CGCACTGGTTCACGCAACCCGTAAACAATTAACGGAAGCCGGCGATAAATTATCCGCAGACGACAAAGCGCCGATTGAAAAAGCGGTCAG
CGAATTGGAAGATGCGGTGAAAGGCGATGACAAAGACGCGATTGAAGCGAAAAGTCAAGCCTTAATCCAAGTTTCCGAAAAATTAATGCA
AGCCGCTCAACAACAAGCGCAGGCAAATACGCAAGGTCAACAATCCCAAGGCGGAAACGACGACGGTGTAGTTGATGCGGAATTTGAAGA
AGTAAAAGATAATAAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine62133 %
Guanine47225 %
Thyamine42223 %
Cytosine39321 %
A+T104355 %
G+C86546 %

Total Bases :   1908 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG7023
AAAAAA18523
AAAAAA36023
AAAAAA36923
AAAAAA63723
AAAAAA73223
AAAAAA126023
CGCGCG139623
CAACAACAA180633
ACGACGACG185533

Microsatellite Map

ATGGGTAAAATTATCGGTATTGACTTAGGTACAACAAATTCTTGTGTTGCGGTGATGGACGGTGACAAACCGCGCGTAATTGAAAATGCA
GAGGGAGATCGTACAACCCCTTCAATTATTGCATACACAAATGATAACGAAACATTAGTCGGTCAACCTGCAAAACGTCAAGCGGTAACC
AATCCAAAAAATACCTTATTCGCAATCAAGCGTTTAATCGGTCGTCGTTTTGAAGACAATGAAGTACAACGCGACGTTGACATTATGCCG
TTCAAAATCATCAGAGCGGATAACGGCGACGCATGGGTTGATGTGAAAGGTGATAAACTGGCGCCACCGCAAGTTTCTGCCGAAGTATTG
AAAAAAATGAAAAAAACGGCGGAAGATTTCTTGGGTGAAACGGTTACCGAAGCGGTAATCACCGTTCCTGCATACTTTAACGACGCACAA
CGCCAGGCAACCAAGGATGCCGGTCGTATTGCCGGTTTAGACGTTAAACGTATTATTAACGAACCGACTGCCGCCGCATTGGCTTACGGG
CTGGATAAAGGCAAGGGCAACCAAACTATTGCGGTTTACGACTTAGGCGGCGGTACCTTCGACTTATCTATCATCGAAATTGATGAAGTC
GGCGGCGAAAAAACCTTCGAAGTACTGGCAACTAACGGTGATACTCACTTAGGCGGCGAAGACTTCGATAACCGTGTAATCAACTATTTG
GTTGACGAATTCAAAAAAGAACAAGGCGTAGATTTACGTAACGATCCGTTAGCAATGCAGCGTTTGAAAGAAGCGGGTGAAAAAGCCAAA
ATCGAATTGTCTTCCGCACAACAAACTGATGTGAACTTACCTTACATCACAGCGGATGCGACTGGTCCTAAACACTTAAACATTAAATTA
ACCCGTGCAAAATTGGAAGCGTTAGTGGAAGATTTGGTGGCTCGTTCGATGGAACCTGTGAAAGTCGCACTGAAAGACGCCGGCTTAAGC
GTTTCTGAAATCGACGACGTCATTTTGGTGGGCGGTCAAACCCGTATGCCGTTGGTGCAACAAAAAGTGGCCGAATTCTTCGGTAAAGAA
CCGCGTAAAGACGTGAATCCGGATGAAGCGGTTGCAGTAGGTGCGGCAGTTCAAGGCGGCGTGTTATCCGGTAATGTAACCGACGTATTA
TTGTTAGACGTTACACCGTTATCATTAGGTATCGAAACCATGGGTGGCGTAATGACAACTCTGATTGAGAAAAACACCACGATTCCGACT
AAAAAATCACAAGTGTTCTCAACGGCGGAAGATAACCAAAGTGCGGTGACTATTCATGTCTTACAAGGTGAACGCAAACAAGCCAGTGCC
AACAAATCGTTGGGTCAATTCAACCTTGAAGGTATTAACCCGGCTCCGCGCGGTATGCCGCAAATTGAAGTGACTTTCGATATTGATGCG
GACGGTATTATCCACGTTTCGGCGAAAGATAAAGGTACCGGTAAAGAACAACAAATTACGATTAAAGCTTCTTCAGGTTTAAGCGATGAA
GAAATTCAACAAATGGTACGTGATGCGGAAGCGAACGCCGATGCGGATCGTAAATTTGAAGAATTGGTTCAGGCGCGTAACCAAGCGGAC
GCACTGGTTCACGCAACCCGTAAACAATTAACGGAAGCCGGCGATAAATTATCCGCAGACGACAAAGCGCCGATTGAAAAAGCGGTCAGC
GAATTGGAAGATGCGGTGAAAGGCGATGACAAAGACGCGATTGAAGCGAAAAGTCAAGCCTTAATCCAAGTTTCCGAAAAATTAATGCAA
GCCGCTCAACAACAAGCGCAGGCAAATACGCAAGGTCAACAATCCCAAGGCGGAAACGACGACGGTGTAGTTGATGCGGAATTTGAAGAA
GTAAAAGATAATAAATAA

Gene Information
Molecule Type genomic DNA
Bases 1908 Bases
Molecular Weight591848.71 Da
Coding Sequence complement(CP000746.1:1209632..1211539)
NCBI ReferenceABR74458
NotesTIGRFAM: chaperone protein DnaK; PFAM: Heat shock

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 387 384 N-terminal nucleotide/ATP binding domain PF00012
Linker 388 to 394 7 Linker region Manually identified
Substrate Binding Domain 395 to 604 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 259 to 279 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACSU1

Accession Number

HSP70_0016

Added on

2012-02-02

Updated On

2014-01-20