Help  Custom Search
 
Chaperone protein hscA of Actinobacillus pleuropneumoniae serotype 5b (str. L20)

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein hscA

Synonymous Names

HSCA_ACTP2, Heat shock 70 kDa protein, HSP70,HscA

Gene names

Gene Name

hscA

Gene Locus Tag

APL_0925

Gene Identifier

4848587

Taxon Information

Organism

Actinobacillus pleuropneumoniae serotype 5b (str. L20)

Organism ID

416269 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus pleuropneumoniae L20

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MALLQIAEPGQTAAPHQHRLAVGIDLGTTNSLVASVRSGQTQVLLDDQERALVPSVVHYGEQQKTVGIEA FAQASLDPQNTVISAKRLIGRSLADVQTRYPDLPYQFIASDNGLPLIQTKQGNKSPVEVSADILSHLNRF AEQRLGGELSGVVITVPAYFDDAQRQSTKDAARLAGLNVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGG GTFDISILRLSRGVFEVLATGGDTALGGDDFDHLLADWIAQQANYQPQNANEQRELLTLATQTKVALSQA VETEVKFANWQGTVSREQFNELIQLLVKRSLMTCRRALKDAGVEGEEIREVVMVGGSTRVPFVREQVGEF FGKQPLTSIDPDKVVALGAAIQADILVGNKPDSEMLLLDVVPLSLGIETMGGLVEKIIPRNMTIPVARAQ EFTTAKDGQTAMSVHVLQGERELVEDCRSLGRFTLRGIPPMVAGAATIRVTYQVDADGLLSVTAMEKSTK VQASIQIKPSYGLTDEEVTQMIKSSMTNAKEDMEARQLAEQRVEADRTIDTVISALQQDGAEVLSVEEFK LIEAEIAKLIQLKQGTDRQAIAQGVKDLDLATQTFAAKRMNLSIQKALAGKAVDEII

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCATTACTTCAAATTGCTGAGCCGGGGCAGACGGCTGCGCCGCATCAGCATCGTTTAGCCGTCGGTATTGACCTTGGTACAACCAA
TTCATTGGTGGCAAGTGTACGTAGCGGGCAAACGCAGGTGTTGTTAGATGATCAGGAACGTGCGTTAGTGCCGTCAGTCGTTCACTACGG
CGAACAACAAAAAACGGTTGGGATTGAAGCATTTGCACAGGCGAGTCTCGATCCGCAAAATACGGTCATTTCGGCGAAACGCTTAATCGG
TCGCTCGCTTGCAGACGTACAAACACGTTATCCGGATTTGCCTTATCAATTTATTGCCAGCGATAACGGCTTGCCACTTATTCAAACCAA
GCAAGGTAATAAAAGCCCGGTTGAAGTGTCGGCGGATATTTTAAGCCACTTAAATCGCTTTGCCGAACAACGTTTAGGCGGGGAATTATC
CGGTGTGGTCATTACCGTGCCGGCGTATTTTGACGATGCACAACGCCAAAGCACTAAAGATGCGGCACGTCTTGCCGGTTTAAACGTATT
ACGTTTATTAAATGAACCGACGGCAGCGGCGATTGCTTACGGTTTGGATAGCGGACAAGAAGGCGTGATTGCGGTCTATGACTTAGGCGG
CGGCACTTTCGATATTTCGATTTTGCGCTTAAGTCGCGGTGTATTTGAAGTGTTGGCGACCGGCGGCGATACCGCACTTGGCGGCGATGA
CTTCGACCATTTACTCGCAGATTGGATTGCACAACAGGCAAATTACCAACCGCAAAATGCTAACGAACAGCGTGAGTTATTAACCCTTGC
CACCCAAACTAAAGTAGCACTTTCACAAGCGGTCGAAACCGAAGTGAAATTTGCAAATTGGCAAGGCACGGTAAGCCGTGAGCAATTTAA
CGAGTTAATTCAACTGTTAGTTAAGCGTTCATTGATGACCTGTCGCCGTGCGTTAAAAGATGCCGGCGTGGAAGGCGAAGAAATCCGTGA
AGTAGTGATGGTGGGCGGTTCGACTCGAGTGCCGTTTGTACGTGAACAAGTCGGTGAGTTTTTCGGTAAGCAGCCTTTAACTTCGATTGA
TCCGGATAAAGTTGTGGCATTAGGGGCGGCGATTCAAGCGGATATTTTAGTCGGTAATAAACCGGACAGCGAAATGCTGCTGTTAGACGT
GGTACCGCTTTCTCTCGGTATCGAAACGATGGGCGGTTTAGTTGAGAAAATTATTCCGCGTAACATGACGATTCCGGTTGCACGTGCGCA
AGAATTTACTACCGCGAAAGACGGTCAAACCGCAATGAGCGTACATGTGTTACAAGGCGAACGTGAGTTGGTCGAAGATTGTCGTTCACT
CGGTCGCTTTACGTTACGAGGCATTCCACCGATGGTTGCCGGTGCGGCGACGATTCGTGTTACTTATCAAGTGGATGCGGACGGTTTGCT
CAGCGTAACGGCAATGGAAAAATCGACTAAAGTGCAGGCTTCGATTCAAATTAAACCGTCTTACGGTTTAACTGACGAAGAAGTTACACA
AATGATTAAATCTTCAATGACCAATGCCAAAGAAGATATGGAAGCCCGCCAACTTGCCGAACAGCGAGTTGAAGCGGACAGAACGATTGA
TACGGTTATTTCGGCATTACAACAAGACGGTGCGGAAGTATTAAGCGTTGAGGAGTTTAAATTAATTGAAGCGGAAATCGCAAAACTGAT
TCAATTAAAACAAGGGACGGATCGACAAGCGATTGCCCAAGGGGTAAAAGATTTAGATCTCGCCACACAAACATTTGCTGCGAAGCGAAT
GAATTTATCAATCCAAAAAGCATTAGCGGGTAAAGCCGTTGATGAGATTATTTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine51628 %
Guanine49227 %
Thyamine46025 %
Cytosine38621 %
A+T97653 %
G+C87848 %

Total Bases :   1854 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA18723
GGCGGCGGC62433
TCTCTC117923
CACACA177223

Microsatellite Map

ATGGCATTACTTCAAATTGCTGAGCCGGGGCAGACGGCTGCGCCGCATCAGCATCGTTTAGCCGTCGGTATTGACCTTGGTACAACCAAT
TCATTGGTGGCAAGTGTACGTAGCGGGCAAACGCAGGTGTTGTTAGATGATCAGGAACGTGCGTTAGTGCCGTCAGTCGTTCACTACGGC
GAACAACAAAAAACGGTTGGGATTGAAGCATTTGCACAGGCGAGTCTCGATCCGCAAAATACGGTCATTTCGGCGAAACGCTTAATCGGT
CGCTCGCTTGCAGACGTACAAACACGTTATCCGGATTTGCCTTATCAATTTATTGCCAGCGATAACGGCTTGCCACTTATTCAAACCAAG
CAAGGTAATAAAAGCCCGGTTGAAGTGTCGGCGGATATTTTAAGCCACTTAAATCGCTTTGCCGAACAACGTTTAGGCGGGGAATTATCC
GGTGTGGTCATTACCGTGCCGGCGTATTTTGACGATGCACAACGCCAAAGCACTAAAGATGCGGCACGTCTTGCCGGTTTAAACGTATTA
CGTTTATTAAATGAACCGACGGCAGCGGCGATTGCTTACGGTTTGGATAGCGGACAAGAAGGCGTGATTGCGGTCTATGACTTAGGCGGC
GGCACTTTCGATATTTCGATTTTGCGCTTAAGTCGCGGTGTATTTGAAGTGTTGGCGACCGGCGGCGATACCGCACTTGGCGGCGATGAC
TTCGACCATTTACTCGCAGATTGGATTGCACAACAGGCAAATTACCAACCGCAAAATGCTAACGAACAGCGTGAGTTATTAACCCTTGCC
ACCCAAACTAAAGTAGCACTTTCACAAGCGGTCGAAACCGAAGTGAAATTTGCAAATTGGCAAGGCACGGTAAGCCGTGAGCAATTTAAC
GAGTTAATTCAACTGTTAGTTAAGCGTTCATTGATGACCTGTCGCCGTGCGTTAAAAGATGCCGGCGTGGAAGGCGAAGAAATCCGTGAA
GTAGTGATGGTGGGCGGTTCGACTCGAGTGCCGTTTGTACGTGAACAAGTCGGTGAGTTTTTCGGTAAGCAGCCTTTAACTTCGATTGAT
CCGGATAAAGTTGTGGCATTAGGGGCGGCGATTCAAGCGGATATTTTAGTCGGTAATAAACCGGACAGCGAAATGCTGCTGTTAGACGTG
GTACCGCTTTCTCTCGGTATCGAAACGATGGGCGGTTTAGTTGAGAAAATTATTCCGCGTAACATGACGATTCCGGTTGCACGTGCGCAA
GAATTTACTACCGCGAAAGACGGTCAAACCGCAATGAGCGTACATGTGTTACAAGGCGAACGTGAGTTGGTCGAAGATTGTCGTTCACTC
GGTCGCTTTACGTTACGAGGCATTCCACCGATGGTTGCCGGTGCGGCGACGATTCGTGTTACTTATCAAGTGGATGCGGACGGTTTGCTC
AGCGTAACGGCAATGGAAAAATCGACTAAAGTGCAGGCTTCGATTCAAATTAAACCGTCTTACGGTTTAACTGACGAAGAAGTTACACAA
ATGATTAAATCTTCAATGACCAATGCCAAAGAAGATATGGAAGCCCGCCAACTTGCCGAACAGCGAGTTGAAGCGGACAGAACGATTGAT
ACGGTTATTTCGGCATTACAACAAGACGGTGCGGAAGTATTAAGCGTTGAGGAGTTTAAATTAATTGAAGCGGAAATCGCAAAACTGATT
CAATTAAAACAAGGGACGGATCGACAAGCGATTGCCCAAGGGGTAAAAGATTTAGATCTCGCCACACAAACATTTGCTGCGAAGCGAATG
AATTTATCAATCCAAAAAGCATTAGCGGGTAAAGCCGTTGATGAGATTATTTAG

Gene Information
Molecule Type genomic DNA
Bases 1854 Bases
Molecular Weight575081.2 Da
Coding Sequence complement(CP000569.1:1067186..1069039)
NCBI ReferenceABN74021
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 21 to 383 363 N-terminal nucleotide/ATP binding domain PF00012
Linker 384 to 390 7 Linker region Manually identified
Substrate Binding Domain 391 to 601 211 C-terminal substrate/peptide binding domain PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACPL2

Accession Number

HSP70_0015

Added on

2012-02-02

Updated On

2014-01-20