Help  Custom Search
 
molecular chaperone DnaK of Actinobacillus pleuropneumoniae serotype 5b (str. L20)

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone DnaK

Synonymous Names

DNAK_ACTP2, Heat shock protein 70, Heat shock 70 kDa protein, HSP70, chaperone protein DnaK, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

APL_1906

Gene Identifier

4848587

Taxon Information

Organism

Actinobacillus pleuropneumoniae serotype 5b (str. L20)

Organism ID

416269 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus pleuropneumoniae L20

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MGKIIGIDLGTTNSCVAVMDGDKARVIENAEGARTTPSIIAYTDNETLVGQPAKRQAITNPKNTLFAIKR LIGRRFESEEVQRDIKIMPFEITRADNGDAWVNVKGDKLAPPQISAEVLKKMKKTAEDFLGEAVTEAVIT VPAYFNDAQRQATIDAGRIAGLDVKRIINEPTAAALAFGLGSTKENQVIAVYDLGGGTFDISIIEIDNFD GEQTFEVLATGGNTHLGGEDFDNRVIDYIIDEFKKEQGVDLRNDPMALQRVKEAAEKAKIELSSAQSTEV NLPYITADATGPKHLAINVTRAKLEALVEDLVASSIESLKTVLKDAGKSVNEINDIILVGGQTRMPLVQQ KVAEFFGKEARKDVNPDEAVAIGAAVQGGVLKGDVKDVLLLDVTPLSLGIETMGGVMTVLIEKNTTIPTK KSQVFSTAEDNQSAVTIHVLQGERKQASANKSLGQFNLEGINPAPRGMPQIEVTFDIDANGVINVSAKDK NTGKEQQIRIQASSGLSDEEIEQMVRDAEANAEADKKFEELVQARNQADGIAHATRKQIEEAGDALNADD KAKIEAAIADLEKAAKGDDKAEIDAKTEALIKASEPLMQAAQAKAQAGEQPQQSAKDDGVVDAEFEEVKD NK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGGTAAAATCATTGGTATTGACTTAGGTACAACAAACTCTTGTGTAGCGGTAATGGACGGTGACAAAGCACGTGTAATCGAGAATGC
GGAAGGTGCACGTACAACTCCGTCAATCATTGCTTATACGGATAACGAAACGTTAGTTGGTCAACCGGCAAAACGTCAGGCGATTACAAA
CCCGAAAAATACATTATTTGCAATCAAACGTTTAATCGGTCGTCGTTTTGAAAGTGAAGAAGTACAACGCGATATTAAAATTATGCCTTT
CGAAATCACACGTGCTGACAACGGCGATGCATGGGTAAACGTAAAAGGCGATAAGTTAGCACCACCGCAAATTTCAGCAGAAGTGTTGAA
AAAAATGAAAAAAACAGCGGAAGATTTCCTTGGTGAAGCGGTAACTGAAGCGGTTATCACTGTGCCGGCATACTTTAACGATGCGCAACG
TCAAGCGACAATCGATGCAGGTCGTATCGCAGGTTTAGATGTTAAACGTATCATCAACGAACCGACAGCAGCAGCGTTAGCGTTCGGTTT
AGGTTCAACTAAAGAAAACCAAGTGATCGCAGTTTACGACTTAGGTGGTGGTACATTCGATATCTCAATCATCGAAATCGATAACTTCGA
CGGCGAACAAACATTCGAAGTATTAGCAACCGGCGGTAACACTCACTTAGGTGGTGAGGACTTCGATAACCGTGTAATCGACTACATTAT
TGACGAGTTCAAAAAAGAACAAGGCGTGGATTTACGCAACGACCCAATGGCATTACAACGTGTTAAAGAAGCGGCGGAAAAAGCGAAAAT
CGAACTTTCTTCAGCACAATCTACCGAAGTAAATCTTCCGTATATCACAGCGGATGCGACAGGTCCTAAACACTTAGCGATCAACGTAAC
CCGTGCGAAATTAGAAGCATTAGTAGAAGATTTAGTTGCAAGCTCAATCGAGTCACTTAAAACCGTATTAAAAGACGCAGGTAAATCAGT
GAATGAAATCAACGACATTATCCTCGTTGGTGGTCAAACACGTATGCCGTTAGTACAACAAAAAGTGGCTGAATTCTTCGGTAAAGAAGC
TCGTAAAGACGTGAATCCGGATGAAGCGGTAGCAATCGGTGCTGCAGTTCAAGGCGGTGTATTAAAAGGTGATGTAAAAGACGTTCTTTT
ATTAGACGTTACACCATTATCTTTAGGTATCGAAACTATGGGCGGCGTGATGACCGTGTTAATTGAGAAAAACACTACGATTCCAACGAA
GAAATCACAAGTGTTCTCAACCGCGGAAGACAATCAATCAGCGGTAACGATCCACGTATTACAAGGTGAGCGTAAACAAGCGTCTGCGAA
CAAATCTTTAGGTCAATTCAACCTTGAAGGTATTAACCCAGCACCACGTGGTATGCCGCAAATCGAAGTAACTTTCGATATCGATGCGAA
CGGTGTAATCAACGTATCTGCGAAAGATAAAAATACAGGTAAAGAGCAACAAATCCGTATCCAAGCGTCTTCAGGTTTATCTGACGAAGA
AATCGAACAAATGGTTCGTGATGCGGAAGCTAACGCAGAAGCGGATAAAAAATTCGAAGAGTTAGTTCAAGCACGTAACCAAGCGGACGG
TATCGCGCATGCAACTCGTAAACAAATCGAAGAAGCTGGTGATGCGTTAAATGCAGATGATAAAGCGAAAATCGAAGCAGCTATCGCTGA
CTTAGAAAAAGCGGCTAAAGGCGATGATAAAGCAGAAATCGATGCGAAAACTGAAGCGTTAATCAAAGCGTCCGAACCTTTAATGCAAGC
GGCTCAAGCTAAAGCGCAAGCAGGTGAACAACCGCAACAATCTGCAAAAGATGACGGCGTAGTGGATGCTGAGTTTGAAGAAGTGAAAGA
TAATAAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine66335 %
Guanine44324 %
Thyamine42423 %
Cytosine36920 %
A+T108758 %
G+C81243 %

Total Bases :   1899 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA35723
AAAAAA36623
CAGCAGCAG51433
GGTGGTGGT58233
AAAAAA72923
AAAAAA157523

Microsatellite Map

ATGGGTAAAATCATTGGTATTGACTTAGGTACAACAAACTCTTGTGTAGCGGTAATGGACGGTGACAAAGCACGTGTAATCGAGAATGCG
GAAGGTGCACGTACAACTCCGTCAATCATTGCTTATACGGATAACGAAACGTTAGTTGGTCAACCGGCAAAACGTCAGGCGATTACAAAC
CCGAAAAATACATTATTTGCAATCAAACGTTTAATCGGTCGTCGTTTTGAAAGTGAAGAAGTACAACGCGATATTAAAATTATGCCTTTC
GAAATCACACGTGCTGACAACGGCGATGCATGGGTAAACGTAAAAGGCGATAAGTTAGCACCACCGCAAATTTCAGCAGAAGTGTTGAAA
AAAATGAAAAAAACAGCGGAAGATTTCCTTGGTGAAGCGGTAACTGAAGCGGTTATCACTGTGCCGGCATACTTTAACGATGCGCAACGT
CAAGCGACAATCGATGCAGGTCGTATCGCAGGTTTAGATGTTAAACGTATCATCAACGAACCGACAGCAGCAGCGTTAGCGTTCGGTTTA
GGTTCAACTAAAGAAAACCAAGTGATCGCAGTTTACGACTTAGGTGGTGGTACATTCGATATCTCAATCATCGAAATCGATAACTTCGAC
GGCGAACAAACATTCGAAGTATTAGCAACCGGCGGTAACACTCACTTAGGTGGTGAGGACTTCGATAACCGTGTAATCGACTACATTATT
GACGAGTTCAAAAAAGAACAAGGCGTGGATTTACGCAACGACCCAATGGCATTACAACGTGTTAAAGAAGCGGCGGAAAAAGCGAAAATC
GAACTTTCTTCAGCACAATCTACCGAAGTAAATCTTCCGTATATCACAGCGGATGCGACAGGTCCTAAACACTTAGCGATCAACGTAACC
CGTGCGAAATTAGAAGCATTAGTAGAAGATTTAGTTGCAAGCTCAATCGAGTCACTTAAAACCGTATTAAAAGACGCAGGTAAATCAGTG
AATGAAATCAACGACATTATCCTCGTTGGTGGTCAAACACGTATGCCGTTAGTACAACAAAAAGTGGCTGAATTCTTCGGTAAAGAAGCT
CGTAAAGACGTGAATCCGGATGAAGCGGTAGCAATCGGTGCTGCAGTTCAAGGCGGTGTATTAAAAGGTGATGTAAAAGACGTTCTTTTA
TTAGACGTTACACCATTATCTTTAGGTATCGAAACTATGGGCGGCGTGATGACCGTGTTAATTGAGAAAAACACTACGATTCCAACGAAG
AAATCACAAGTGTTCTCAACCGCGGAAGACAATCAATCAGCGGTAACGATCCACGTATTACAAGGTGAGCGTAAACAAGCGTCTGCGAAC
AAATCTTTAGGTCAATTCAACCTTGAAGGTATTAACCCAGCACCACGTGGTATGCCGCAAATCGAAGTAACTTTCGATATCGATGCGAAC
GGTGTAATCAACGTATCTGCGAAAGATAAAAATACAGGTAAAGAGCAACAAATCCGTATCCAAGCGTCTTCAGGTTTATCTGACGAAGAA
ATCGAACAAATGGTTCGTGATGCGGAAGCTAACGCAGAAGCGGATAAAAAATTCGAAGAGTTAGTTCAAGCACGTAACCAAGCGGACGGT
ATCGCGCATGCAACTCGTAAACAAATCGAAGAAGCTGGTGATGCGTTAAATGCAGATGATAAAGCGAAAATCGAAGCAGCTATCGCTGAC
TTAGAAAAAGCGGCTAAAGGCGATGATAAAGCAGAAATCGATGCGAAAACTGAAGCGTTAATCAAAGCGTCCGAACCTTTAATGCAAGCG
GCTCAAGCTAAAGCGCAAGCAGGTGAACAACCGCAACAATCTGCAAAAGATGACGGCGTAGTGGATGCTGAGTTTGAAGAAGTGAAAGAT
AATAAATAA

Gene Information
Molecule Type genomic DNA
Bases 1899 Bases
Molecular Weight589124.52 Da
Coding Sequence complement(CP000569.1:2136557..2138455)
NCBI ReferenceABN74986
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 386 383 N-terminal nucleotide/ATP binding domain PF00012
Linker 387 to 393 7 Linker region Manually identified
Substrate Binding Domain 394 to 603 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 258 to 278 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACPL1

Accession Number

HSP70_0014

Added on

2012-02-02

Updated On

2014-01-20