Help  Custom Search
 
Fe-S protein assembly chaperone HscA of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Fe-S protein assembly chaperone HscA

Synonymous Names

HSCA_ACIB5, Heat shock 70 kDa protein,HSP70, HscA

Gene names

Gene Name

hscA

Gene Locus Tag

AB57_1852

Gene Identifier

7044036

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria ; Proteobacteria ; Gammaproteobacteria ; Pseudomonadales ; Moraxellaceae ; Acinetobacter; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MALLQIAEPGQSSAPHQHRIAIGIDLGTTHSLVATVLSGKPKVLNDVQNRRLLPSIVHYGDNTTHYGEEA KPFIIADPKNTIVSVKRFMGRSKADIKFQHPYELVGSENEMPAFETRAGRKTPVEISAEILKQLKDRAED SLQNPVNGAVITVPAYFDEAQRQATRDAAQLAGLNVLRLLNEPTAAAVAYGLDQESNLATDRNYVIYDLG GGTFDVSILRFSQGVFEVLATGGHTALGGDDLDRLIVKWAKKQLNIDVLSDEDYAVFIVAARQAKEQLST QDSVELKLLEATLTLDRPTFESIIQVALDKTISVCKRVLRDAKLELTDIQNVVLVGGSTRSYAVQKAVRE VFAQEPLCTINPDEVVAIGASITANQLIGNSQDGSLLLDVTPLSLGLETMGGLVERLISRNTAIPVARRQ EFTTYQDGQTAMLIHVVQGERDLVEHCRSLGRFVLHGIPPMTAGQARIEVTFQVDADGLLTVSAREATSG VQAHIDIKPSYGLSEADTERLLIEGFQHAEEDKNLRHLKETKVEAERELESLEQALKVDADLLDEKQLDA LNSAKESLKAQLEGSDIQAIEHAVQQLKVHSDAFAALRMNRHIDHALKGTKLDDWSKSN

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCACTTTTGCAAATTGCTGAACCGGGTCAATCCAGTGCCCCACACCAACATCGCATTGCGATTGGTATTGACCTAGGAACAACACA
CTCATTAGTTGCGACAGTGTTATCAGGCAAACCTAAAGTACTCAATGATGTTCAAAATAGAAGATTACTTCCTTCTATCGTTCATTATGG
GGACAATACAACTCATTATGGTGAAGAAGCTAAACCGTTTATCATTGCAGATCCAAAAAATACAATTGTTTCTGTTAAACGATTTATGGG
CCGTTCAAAGGCAGATATTAAATTTCAACACCCTTATGAGTTAGTAGGCTCAGAAAATGAAATGCCTGCTTTTGAAACCCGTGCTGGACG
CAAAACACCAGTAGAAATCTCAGCTGAAATTTTAAAACAATTAAAAGATCGCGCTGAAGACAGCTTACAAAATCCTGTTAATGGAGCAGT
AATTACCGTTCCTGCATATTTCGATGAAGCTCAGCGTCAAGCAACTCGCGATGCAGCTCAACTTGCAGGTTTAAATGTATTACGTTTATT
AAATGAGCCTACAGCTGCCGCTGTAGCTTATGGATTAGATCAAGAAAGTAATTTAGCGACCGACCGTAATTATGTAATTTATGACTTGGG
TGGCGGTACTTTTGACGTATCTATCTTACGTTTTTCACAAGGCGTATTCGAAGTTTTAGCGACTGGTGGTCACACTGCTTTAGGTGGTGA
TGACTTAGACCGTCTAATCGTAAAATGGGCTAAAAAACAACTTAATATTGATGTATTAAGTGATGAAGATTATGCCGTATTTATTGTGGC
AGCACGTCAAGCTAAAGAACAATTATCAACTCAAGATTCAGTTGAATTAAAGTTACTCGAAGCAACTCTCACACTAGATCGCCCTACATT
TGAAAGCATTATTCAAGTAGCATTAGACAAAACGATTAGTGTTTGTAAGCGTGTACTGCGTGATGCAAAACTCGAGTTAACCGATATTCA
AAATGTTGTTTTGGTAGGTGGTTCTACTCGCTCTTATGCTGTTCAAAAAGCAGTACGGGAAGTTTTTGCCCAAGAACCTCTTTGCACGAT
CAACCCAGATGAAGTGGTGGCAATTGGCGCTTCTATTACAGCCAACCAGTTAATCGGTAATAGCCAAGATGGCTCTCTTCTTTTAGATGT
AACTCCTCTTTCTCTTGGTCTAGAGACTATGGGAGGACTCGTTGAGCGCCTGATATCTCGTAATACAGCGATTCCTGTTGCACGTCGTCA
AGAGTTCACCACTTATCAAGATGGTCAAACTGCTATGTTAATTCATGTAGTTCAAGGCGAACGTGATTTAGTTGAACATTGCCGTTCATT
AGGTAGATTTGTACTTCATGGCATTCCACCAATGACTGCAGGCCAAGCTCGTATTGAAGTCACTTTCCAAGTTGATGCAGATGGCTTACT
CACCGTTTCTGCTCGTGAAGCAACTTCTGGCGTGCAAGCTCATATTGATATCAAACCATCTTATGGTTTATCTGAGGCAGATACGGAACG
CTTATTAATTGAAGGTTTCCAACATGCCGAAGAGGACAAAAATCTTCGTCATTTAAAAGAAACTAAAGTTGAAGCAGAACGTGAGCTTGA
GTCTCTTGAGCAAGCATTAAAAGTAGATGCGGATTTACTTGATGAAAAGCAGCTTGACGCACTCAACTCTGCTAAGGAATCATTAAAAGC
TCAGCTTGAAGGCAGTGATATTCAAGCAATTGAGCACGCAGTTCAACAACTTAAAGTACATAGTGATGCTTTTGCAGCACTACGGATGAA
TCGACATATTGACCATGCCTTAAAAGGCACGAAGCTCGATGATTGGTCAAAATCAAATTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine57231 %
Guanine38221 %
Thyamine53929 %
Cytosine36720 %
A+T111160 %
G+C74941 %

Total Bases :   1860 bases

Microsatellites
SequencePosition LengthRepeats
ACACAC8423
AAAAAA23323
AAAAAA75023
CTCTCT115123

Microsatellite Map

ATGGCACTTTTGCAAATTGCTGAACCGGGTCAATCCAGTGCCCCACACCAACATCGCATTGCGATTGGTATTGACCTAGGAACAACACAC
TCATTAGTTGCGACAGTGTTATCAGGCAAACCTAAAGTACTCAATGATGTTCAAAATAGAAGATTACTTCCTTCTATCGTTCATTATGGG
GACAATACAACTCATTATGGTGAAGAAGCTAAACCGTTTATCATTGCAGATCCAAAAAATACAATTGTTTCTGTTAAACGATTTATGGGC
CGTTCAAAGGCAGATATTAAATTTCAACACCCTTATGAGTTAGTAGGCTCAGAAAATGAAATGCCTGCTTTTGAAACCCGTGCTGGACGC
AAAACACCAGTAGAAATCTCAGCTGAAATTTTAAAACAATTAAAAGATCGCGCTGAAGACAGCTTACAAAATCCTGTTAATGGAGCAGTA
ATTACCGTTCCTGCATATTTCGATGAAGCTCAGCGTCAAGCAACTCGCGATGCAGCTCAACTTGCAGGTTTAAATGTATTACGTTTATTA
AATGAGCCTACAGCTGCCGCTGTAGCTTATGGATTAGATCAAGAAAGTAATTTAGCGACCGACCGTAATTATGTAATTTATGACTTGGGT
GGCGGTACTTTTGACGTATCTATCTTACGTTTTTCACAAGGCGTATTCGAAGTTTTAGCGACTGGTGGTCACACTGCTTTAGGTGGTGAT
GACTTAGACCGTCTAATCGTAAAATGGGCTAAAAAACAACTTAATATTGATGTATTAAGTGATGAAGATTATGCCGTATTTATTGTGGCA
GCACGTCAAGCTAAAGAACAATTATCAACTCAAGATTCAGTTGAATTAAAGTTACTCGAAGCAACTCTCACACTAGATCGCCCTACATTT
GAAAGCATTATTCAAGTAGCATTAGACAAAACGATTAGTGTTTGTAAGCGTGTACTGCGTGATGCAAAACTCGAGTTAACCGATATTCAA
AATGTTGTTTTGGTAGGTGGTTCTACTCGCTCTTATGCTGTTCAAAAAGCAGTACGGGAAGTTTTTGCCCAAGAACCTCTTTGCACGATC
AACCCAGATGAAGTGGTGGCAATTGGCGCTTCTATTACAGCCAACCAGTTAATCGGTAATAGCCAAGATGGCTCTCTTCTTTTAGATGTA
ACTCCTCTTTCTCTTGGTCTAGAGACTATGGGAGGACTCGTTGAGCGCCTGATATCTCGTAATACAGCGATTCCTGTTGCACGTCGTCAA
GAGTTCACCACTTATCAAGATGGTCAAACTGCTATGTTAATTCATGTAGTTCAAGGCGAACGTGATTTAGTTGAACATTGCCGTTCATTA
GGTAGATTTGTACTTCATGGCATTCCACCAATGACTGCAGGCCAAGCTCGTATTGAAGTCACTTTCCAAGTTGATGCAGATGGCTTACTC
ACCGTTTCTGCTCGTGAAGCAACTTCTGGCGTGCAAGCTCATATTGATATCAAACCATCTTATGGTTTATCTGAGGCAGATACGGAACGC
TTATTAATTGAAGGTTTCCAACATGCCGAAGAGGACAAAAATCTTCGTCATTTAAAAGAAACTAAAGTTGAAGCAGAACGTGAGCTTGAG
TCTCTTGAGCAAGCATTAAAAGTAGATGCGGATTTACTTGATGAAAAGCAGCTTGACGCACTCAACTCTGCTAAGGAATCATTAAAAGCT
CAGCTTGAAGGCAGTGATATTCAAGCAATTGAGCACGCAGTTCAACAACTTAAAGTACATAGTGATGCTTTTGCAGCACTACGGATGAAT
CGACATATTGACCATGCCTTAAAAGGCACGAAGCTCGATGATTGGTCAAAATCAAATTAA

Gene Information
Molecule Type genomic DNA
Bases 1860 Bases
Molecular Weight574945.24 Da
Coding Sequence complement(CP001182.1:1939863..1941722)
NCBI ReferenceACJ41231
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 21 to 382 362 N-terminal nucleotide/ATP binding domain PF00012
Linker 383 to 390 8 Linker region Manually identified
Substrate Binding Domain 391 to 600 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 518 to 552 35 Coiled coil region Manually identified
Coiled coil 558 to 578 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACBA2

Accession Number

HSP70_0013

Added on

2012-02-02

Updated On

2014-01-20