Help  Custom Search
 
chaperone protein DnaK of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone protein DnaK

Synonymous Names

DNAK_ACIB5, Heat shock protein 70, Heat shock 70 kDa protein,HSP70,DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

AB57_0048

Gene Identifier

7043988

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MAKIIGIDLGTTNSCVAVLEGDKVKVIENAEGARTTPSIIAYKDGEILVGQSAKRQAVTNPKNTLFAIKR LIGRRYEDQAVQKDIGLVPYKIIKADNGDAWVEVNDKKLAPQQISAEILKKMKKTAEDYLGETVTEAVIT VPAYFNDAQRQATKDAGKIAGLDVKRIINEPTAAALAFGMDKKEGDRKVAVYDLGGGTFDVSIIEIADLD GDQQIEVLSTNGDTFLGGEDFDNALIEYLVEEFKKEQNVNLKNDPLALQRLKEAAEKAKIELSSSNATEI NLPYITADATGPKHLVINVTRAKLEGLVADLVARTIEPCKIALKDAGLSTSDISDVILVGGQSRMPLVQQ KVQEFFGREPRKDVNPDEAVAIGAAIQGAVLSGDKNDVLLLDVTPLTLGIETMGGVLTPIIEKNTTIPAK KSQVFSTAADNQPAVDISVYQGERKMAQQNKLLGNFQLGDIPPAPRGVPQIEVSFDINADGILKVSAKDK STGKEQSIQIKANSGLSDAEIEAMIKDAEANAEEDRKFEELAKARNEADALISSSNKAVKDLGDKVTEDE KTAVNTAVSELEAATKENDVEVIKAKTEALQNILMPITQRAYEQAQQAGGAEGFDPNAFQGGDAGQQKAD DGVVDAEFTEVKDDKK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAAAAATTATTGGTATTGACTTAGGTACTACCAACTCATGTGTTGCTGTACTTGAAGGCGATAAAGTAAAAGTAATCGAAAACGC
AGAAGGCGCACGTACAACTCCATCGATCATTGCATATAAAGATGGAGAGATCTTAGTGGGCCAAAGCGCTAAGCGTCAGGCAGTAACAAA
CCCTAAAAATACATTATTCGCGATCAAGCGTTTAATTGGTCGTCGTTATGAAGATCAAGCAGTACAAAAAGACATCGGTCTTGTACCTTA
TAAAATCATCAAAGCAGACAACGGTGATGCTTGGGTTGAAGTAAACGATAAAAAACTAGCACCTCAACAGATCTCTGCTGAAATCTTGAA
AAAGATGAAAAAAACTGCAGAAGATTATTTAGGTGAAACAGTAACTGAAGCTGTAATTACTGTTCCTGCTTACTTTAACGATGCTCAACG
TCAAGCAACTAAAGATGCGGGTAAAATCGCTGGTTTAGATGTTAAACGTATCATTAACGAACCAACTGCTGCTGCACTTGCGTTCGGTAT
GGACAAAAAAGAAGGCGACCGTAAAGTTGCAGTTTACGACTTAGGTGGTGGTACATTTGACGTATCTATCATTGAAATCGCGGATCTTGA
TGGCGACCAACAAATTGAAGTGTTATCAACTAACGGTGATACTTTCCTTGGTGGTGAAGACTTCGATAACGCGTTAATTGAATACTTGGT
TGAAGAATTCAAGAAAGAACAAAACGTAAACTTGAAAAACGATCCACTTGCGTTACAACGTTTGAAAGAAGCTGCTGAAAAAGCAAAAAT
CGAGCTTTCTTCTTCGAATGCAACTGAAATCAACCTTCCATACATCACTGCTGATGCGACTGGTCCTAAACACTTAGTGATCAACGTAAC
TCGTGCAAAACTTGAAGGTTTAGTTGCTGATTTAGTTGCTCGTACTATCGAACCTTGTAAGATTGCTCTTAAAGATGCTGGTCTTTCGAC
TTCTGACATCTCTGACGTCATCTTAGTTGGTGGTCAGTCTCGTATGCCACTTGTACAACAAAAAGTACAAGAATTCTTCGGTAGAGAACC
ACGTAAAGACGTGAACCCTGACGAAGCAGTTGCAATCGGTGCCGCAATTCAAGGTGCTGTATTGTCTGGTGACAAGAACGACGTATTGCT
TCTTGACGTAACACCATTAACTTTAGGTATTGAAACAATGGGTGGTGTATTAACACCAATCATTGAGAAAAACACAACGATTCCTGCGAA
GAAATCACAAGTGTTCTCTACTGCTGCTGATAACCAACCAGCGGTAGATATTTCAGTTTACCAAGGTGAACGTAAGATGGCTCAACAAAA
CAAATTGTTGGGTAACTTCCAGTTAGGTGACATCCCACCTGCTCCACGTGGTGTGCCACAAATTGAAGTATCTTTCGATATTAACGCTGA
CGGTATTTTGAAAGTGTCTGCAAAAGACAAGAGCACTGGTAAAGAGCAATCGATCCAGATTAAGGCAAACTCAGGTTTATCTGATGCTGA
AATCGAAGCGATGATTAAAGATGCAGAAGCAAATGCTGAAGAAGACCGTAAGTTTGAAGAACTTGCAAAAGCTCGTAACGAAGCTGATGC
ATTAATTTCAAGCTCAAACAAAGCTGTTAAAGATCTTGGTGACAAAGTGACTGAAGATGAAAAAACAGCTGTAAATACAGCAGTTTCTGA
ACTTGAAGCAGCAACAAAAGAAAATGATGTTGAAGTAATCAAAGCGAAAACTGAAGCTTTACAAAACATCTTAATGCCGATCACTCAACG
TGCTTATGAACAAGCGCAACAAGCTGGCGGTGCTGAAGGTTTCGATCCAAATGCATTCCAAGGTGGTGATGCTGGTCAACAAAAAGCAGA
CGATGGCGTTGTAGATGCTGAGTTCACTGAAGTAAAAGATGACAAAAAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine66535 %
Guanine41822 %
Thyamine49626 %
Cytosine36219 %
A+T116160 %
G+C78041 %

Total Bases :   1941 bases

Microsatellites
SequencePosition LengthRepeats
GAGAGA13323
AAAAAA31823
AAAAAA36623
CTGCTGCTG51433
AAAAAA54323
GGTGGTGGT58233
TTCTTCTTC81533
CTGCTGCTG127933
AAAAAA167823
AAAAAA193223

Microsatellite Map

ATGGCAAAAATTATTGGTATTGACTTAGGTACTACCAACTCATGTGTTGCTGTACTTGAAGGCGATAAAGTAAAAGTAATCGAAAACGCA
GAAGGCGCACGTACAACTCCATCGATCATTGCATATAAAGATGGAGAGATCTTAGTGGGCCAAAGCGCTAAGCGTCAGGCAGTAACAAAC
CCTAAAAATACATTATTCGCGATCAAGCGTTTAATTGGTCGTCGTTATGAAGATCAAGCAGTACAAAAAGACATCGGTCTTGTACCTTAT
AAAATCATCAAAGCAGACAACGGTGATGCTTGGGTTGAAGTAAACGATAAAAAACTAGCACCTCAACAGATCTCTGCTGAAATCTTGAAA
AAGATGAAAAAAACTGCAGAAGATTATTTAGGTGAAACAGTAACTGAAGCTGTAATTACTGTTCCTGCTTACTTTAACGATGCTCAACGT
CAAGCAACTAAAGATGCGGGTAAAATCGCTGGTTTAGATGTTAAACGTATCATTAACGAACCAACTGCTGCTGCACTTGCGTTCGGTATG
GACAAAAAAGAAGGCGACCGTAAAGTTGCAGTTTACGACTTAGGTGGTGGTACATTTGACGTATCTATCATTGAAATCGCGGATCTTGAT
GGCGACCAACAAATTGAAGTGTTATCAACTAACGGTGATACTTTCCTTGGTGGTGAAGACTTCGATAACGCGTTAATTGAATACTTGGTT
GAAGAATTCAAGAAAGAACAAAACGTAAACTTGAAAAACGATCCACTTGCGTTACAACGTTTGAAAGAAGCTGCTGAAAAAGCAAAAATC
GAGCTTTCTTCTTCGAATGCAACTGAAATCAACCTTCCATACATCACTGCTGATGCGACTGGTCCTAAACACTTAGTGATCAACGTAACT
CGTGCAAAACTTGAAGGTTTAGTTGCTGATTTAGTTGCTCGTACTATCGAACCTTGTAAGATTGCTCTTAAAGATGCTGGTCTTTCGACT
TCTGACATCTCTGACGTCATCTTAGTTGGTGGTCAGTCTCGTATGCCACTTGTACAACAAAAAGTACAAGAATTCTTCGGTAGAGAACCA
CGTAAAGACGTGAACCCTGACGAAGCAGTTGCAATCGGTGCCGCAATTCAAGGTGCTGTATTGTCTGGTGACAAGAACGACGTATTGCTT
CTTGACGTAACACCATTAACTTTAGGTATTGAAACAATGGGTGGTGTATTAACACCAATCATTGAGAAAAACACAACGATTCCTGCGAAG
AAATCACAAGTGTTCTCTACTGCTGCTGATAACCAACCAGCGGTAGATATTTCAGTTTACCAAGGTGAACGTAAGATGGCTCAACAAAAC
AAATTGTTGGGTAACTTCCAGTTAGGTGACATCCCACCTGCTCCACGTGGTGTGCCACAAATTGAAGTATCTTTCGATATTAACGCTGAC
GGTATTTTGAAAGTGTCTGCAAAAGACAAGAGCACTGGTAAAGAGCAATCGATCCAGATTAAGGCAAACTCAGGTTTATCTGATGCTGAA
ATCGAAGCGATGATTAAAGATGCAGAAGCAAATGCTGAAGAAGACCGTAAGTTTGAAGAACTTGCAAAAGCTCGTAACGAAGCTGATGCA
TTAATTTCAAGCTCAAACAAAGCTGTTAAAGATCTTGGTGACAAAGTGACTGAAGATGAAAAAACAGCTGTAAATACAGCAGTTTCTGAA
CTTGAAGCAGCAACAAAAGAAAATGATGTTGAAGTAATCAAAGCGAAAACTGAAGCTTTACAAAACATCTTAATGCCGATCACTCAACGT
GCTTATGAACAAGCGCAACAAGCTGGCGGTGCTGAAGGTTTCGATCCAAATGCATTCCAAGGTGGTGATGCTGGTCAACAAAAAGCAGAC
GATGGCGTTGTAGATGCTGAGTTCACTGAAGTAAAAGATGACAAAAAATAA

Gene Information
Molecule Type genomic DNA
Bases 1941 Bases
Molecular Weight601398.83 Da
Coding Sequence complement(CP001182.1:47619..49559)
NCBI ReferenceACJ39480
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 386 383 N-terminal nucleotide/ATP binding domain PF00012
Linker 387 to 393 7 Linker region Manually identified
Substrate Binding Domain 394 to 603 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 258 to 278 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACBA1

Accession Number

HSP70_0012

Added on

2012-02-02

Updated On

2014-01-20