Help  Custom Search
 
molecular chaperone DnaK of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone DnaK

Synonymous Names

DNAK_ACIC1, Heat shock protein 70, Heat shock 70 kDa protein, DnaK, HSP70

Gene names

Gene Name

dnaK

Gene Locus Tag

Acel_2115

Gene Identifier

4484969

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MARAVGIDLGTTNSVIAVLEGGEPTVIPNAEGSRTTPSVVAFAKNGEVLVGEVAKRQAVTNAERTIRSVK RHMGTNWTIDIDGKKYTPQEISARILMKLKRDAEAYLGEQISDAVITVPAYFNDAQRQATKEAGQIAGLN VLRIINEPTAAALAYGLDKGEKEQTILVFDLGGGTFDVSLLEIGEGIVEVKATSGDTHLGGDDWDQRIVD HLVTTFKNQHGIDLSKDKMAMQRLKEAAERAKIELSSAMETTINLPYITASSEGPLHLEVKLTRSEFQRM TADLLERCKGPFNQAIKDAGITVNQIDHVILVGGSTRMPAVVDLVRELTGGKEPNKGVNPDEVVAVGACL QAGVLKGEVKDVLLLDVTPLSLGIETKGGVFTKLIERNTTIPTRRSEIFTTAEDNQPSVQIQVYQGEREI AAYNKKLGMFELTGLPPAPRGVPQIEVTFDIDANGIVHVSAKDLATGKEQSMTITGGSALPKEEIERMMR DAEAHAEEDRRRREEAEARNQADTLIYQTEKFLRENADKVPAAEKANVETAIANLKKAMEGSDVTAIRSA TEQLATESQKLGAAMYAATQAAAGGSSGSATGATGSASGSAGKDDEVVDAEIVDEGEK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCACGTGCGGTCGGAATCGACCTCGGTACCACCAACTCTGTGATCGCCGTCCTTGAGGGCGGCGAACCGACAGTGATCCCCAACGC
GGAAGGGTCACGCACCACGCCGTCGGTGGTCGCGTTCGCTAAGAACGGCGAGGTGCTCGTTGGTGAAGTGGCCAAACGACAGGCGGTCAC
CAACGCGGAGCGGACCATCCGTTCGGTCAAGCGGCACATGGGCACGAACTGGACGATCGACATCGACGGCAAGAAATACACGCCGCAAGA
GATCAGTGCCCGTATCCTGATGAAACTCAAGCGCGACGCCGAGGCATACCTGGGCGAGCAGATCAGCGACGCGGTCATCACGGTTCCGGC
GTACTTCAACGACGCGCAACGCCAGGCAACCAAGGAGGCCGGCCAAATCGCCGGACTCAACGTGCTCCGGATCATCAACGAGCCGACGGC
GGCGGCGCTGGCCTACGGGCTGGACAAGGGTGAGAAAGAGCAGACGATTCTCGTCTTCGACCTCGGCGGCGGCACCTTCGACGTCTCCCT
CCTCGAAATCGGCGAGGGAATCGTCGAAGTCAAAGCCACCAGCGGCGACACCCACCTCGGTGGTGACGACTGGGACCAGCGCATCGTCGA
CCACCTCGTCACCACGTTCAAGAACCAGCACGGGATCGACTTGTCAAAAGACAAGATGGCCATGCAGCGGCTCAAGGAAGCCGCCGAGCG
GGCGAAGATCGAGCTGTCCTCCGCGATGGAGACGACCATCAATCTGCCGTACATCACGGCCAGCTCGGAAGGCCCGCTCCACCTGGAGGT
GAAGCTCACCCGGTCGGAATTCCAGCGGATGACCGCGGACCTGCTCGAGCGGTGCAAGGGGCCGTTCAATCAGGCAATCAAGGACGCCGG
CATCACCGTGAACCAGATCGACCACGTCATTCTCGTCGGCGGCTCAACCCGGATGCCCGCGGTTGTCGACCTGGTCCGCGAACTGACCGG
CGGCAAGGAGCCGAACAAGGGCGTCAACCCTGACGAAGTCGTCGCCGTCGGCGCATGTCTGCAGGCCGGCGTCCTCAAGGGTGAAGTGAA
GGACGTCCTGCTCCTCGACGTCACACCGCTCTCCCTCGGCATCGAGACGAAGGGCGGCGTGTTCACCAAGCTCATCGAGCGGAACACCAC
GATCCCGACGCGCCGGTCGGAAATCTTCACGACGGCGGAAGACAACCAGCCGAGCGTGCAGATCCAGGTGTACCAAGGAGAGCGGGAAAT
CGCCGCGTACAACAAGAAACTCGGAATGTTCGAGTTGACCGGCCTGCCGCCTGCGCCGCGCGGCGTCCCGCAGATCGAGGTCACCTTCGA
CATTGACGCCAACGGCATCGTGCATGTCTCCGCAAAAGACCTCGCCACCGGAAAAGAGCAATCCATGACGATTACCGGCGGGTCGGCGCT
TCCCAAGGAAGAAATTGAGCGCATGATGCGCGACGCCGAAGCGCACGCCGAAGAAGACCGGCGGCGGCGCGAAGAGGCGGAAGCCCGCAA
CCAGGCGGACACGCTCATCTACCAGACCGAGAAATTCCTGCGGGAGAACGCCGACAAGGTGCCTGCCGCGGAGAAGGCAAACGTCGAGAC
GGCCATCGCGAATCTGAAGAAGGCGATGGAGGGCAGCGACGTCACGGCGATTCGTTCGGCCACCGAGCAGCTCGCCACCGAAAGTCAGAA
GCTGGGCGCGGCGATGTACGCCGCGACGCAGGCGGCCGCCGGTGGATCGAGCGGATCAGCGACCGGCGCGACCGGCAGTGCGTCCGGTTC
GGCCGGCAAGGACGACGAAGTGGTCGATGCGGAAATCGTCGACGAGGGTGAGAAGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine42924 %
Guanine59833 %
Thyamine24714 %
Cytosine58332 %
A+T67637 %
G+C118164 %

Total Bases :   1857 bases

Microsatellites
SequencePosition LengthRepeats
CGGCGGCGG44533
CGGCGGCGG51233
CGCGCG131523
CGGCGGCGG149733

Microsatellite Map

ATGGCACGTGCGGTCGGAATCGACCTCGGTACCACCAACTCTGTGATCGCCGTCCTTGAGGGCGGCGAACCGACAGTGATCCCCAACGCG
GAAGGGTCACGCACCACGCCGTCGGTGGTCGCGTTCGCTAAGAACGGCGAGGTGCTCGTTGGTGAAGTGGCCAAACGACAGGCGGTCACC
AACGCGGAGCGGACCATCCGTTCGGTCAAGCGGCACATGGGCACGAACTGGACGATCGACATCGACGGCAAGAAATACACGCCGCAAGAG
ATCAGTGCCCGTATCCTGATGAAACTCAAGCGCGACGCCGAGGCATACCTGGGCGAGCAGATCAGCGACGCGGTCATCACGGTTCCGGCG
TACTTCAACGACGCGCAACGCCAGGCAACCAAGGAGGCCGGCCAAATCGCCGGACTCAACGTGCTCCGGATCATCAACGAGCCGACGGCG
GCGGCGCTGGCCTACGGGCTGGACAAGGGTGAGAAAGAGCAGACGATTCTCGTCTTCGACCTCGGCGGCGGCACCTTCGACGTCTCCCTC
CTCGAAATCGGCGAGGGAATCGTCGAAGTCAAAGCCACCAGCGGCGACACCCACCTCGGTGGTGACGACTGGGACCAGCGCATCGTCGAC
CACCTCGTCACCACGTTCAAGAACCAGCACGGGATCGACTTGTCAAAAGACAAGATGGCCATGCAGCGGCTCAAGGAAGCCGCCGAGCGG
GCGAAGATCGAGCTGTCCTCCGCGATGGAGACGACCATCAATCTGCCGTACATCACGGCCAGCTCGGAAGGCCCGCTCCACCTGGAGGTG
AAGCTCACCCGGTCGGAATTCCAGCGGATGACCGCGGACCTGCTCGAGCGGTGCAAGGGGCCGTTCAATCAGGCAATCAAGGACGCCGGC
ATCACCGTGAACCAGATCGACCACGTCATTCTCGTCGGCGGCTCAACCCGGATGCCCGCGGTTGTCGACCTGGTCCGCGAACTGACCGGC
GGCAAGGAGCCGAACAAGGGCGTCAACCCTGACGAAGTCGTCGCCGTCGGCGCATGTCTGCAGGCCGGCGTCCTCAAGGGTGAAGTGAAG
GACGTCCTGCTCCTCGACGTCACACCGCTCTCCCTCGGCATCGAGACGAAGGGCGGCGTGTTCACCAAGCTCATCGAGCGGAACACCACG
ATCCCGACGCGCCGGTCGGAAATCTTCACGACGGCGGAAGACAACCAGCCGAGCGTGCAGATCCAGGTGTACCAAGGAGAGCGGGAAATC
GCCGCGTACAACAAGAAACTCGGAATGTTCGAGTTGACCGGCCTGCCGCCTGCGCCGCGCGGCGTCCCGCAGATCGAGGTCACCTTCGAC
ATTGACGCCAACGGCATCGTGCATGTCTCCGCAAAAGACCTCGCCACCGGAAAAGAGCAATCCATGACGATTACCGGCGGGTCGGCGCTT
CCCAAGGAAGAAATTGAGCGCATGATGCGCGACGCCGAAGCGCACGCCGAAGAAGACCGGCGGCGGCGCGAAGAGGCGGAAGCCCGCAAC
CAGGCGGACACGCTCATCTACCAGACCGAGAAATTCCTGCGGGAGAACGCCGACAAGGTGCCTGCCGCGGAGAAGGCAAACGTCGAGACG
GCCATCGCGAATCTGAAGAAGGCGATGGAGGGCAGCGACGTCACGGCGATTCGTTCGGCCACCGAGCAGCTCGCCACCGAAAGTCAGAAG
CTGGGCGCGGCGATGTACGCCGCGACGCAGGCGGCCGCCGGTGGATCGAGCGGATCAGCGACCGGCGCGACCGGCAGTGCGTCCGGTTCG
GCCGGCAAGGACGACGAAGTGGTCGATGCGGAAATCGTCGACGAGGGTGAGAAGTGA

Gene Information
Molecule Type genomic DNA
Bases 1857 Bases
Molecular Weight574902.05 Da
Coding Sequence CP000481.1:2393734..2395590
NCBI ReferenceABK53887
NotesTIGRFAM: chaperone protein DnaK; PFAM: Heat shock

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 76 to 360 285 N-terminal nucleotide/ATP binding domain PF00012
Linker 361 to 367 7 Linker region Manually identified
Substrate Binding Domain 368 to 577 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 224 to 251 28 Coiled coil region Manually identified
Coiled coil 482 to 509 28 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACCE1

Accession Number

HSP70_0011

Added on

2012-02-02

Updated On

2014-01-20