Help  Custom Search
 
Fe-S protein assembly chaperone hscA of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Fe-S protein assembly chaperone hscA

Synonymous Names

C1F201_ACIC5, HscA, HSP70, chaperone protein hscA homolog

Gene names

Gene Name

hscA

Gene Locus Tag

ACP_2549

Gene Identifier

7699376

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MSENVQERIVGIDLGTTNSLIAFMQGEQPVVIPGEDGSRLVPSVVAIPSAKQIVVGNAARQYLAETPERV VYSAKRLMGRGVEDVQEELKLFPFRIASDLQTGEVIRLQIGEQQFTPPEISAYVLRQLKRNAERYFGAPV TKAVITVPAYFNDAQRQATKDAGRMAGLEVLRLVNEPTAAALAYGLDRAKEGIVAVYDLGGGTFDISILK LHDGIFEVIATNGDTHLGGDDIDNLLIAIALDDIHGELNLDLRHDAAAVQAIRKAVIEAKIALSSSDSAR ISVDLPGGVPYRREITREQFQQLVKPILDRTVGPCLAAMKDAGIQPEQIDEVVLVGGSTRIPAVWQLTDE LFHLAPRGKKPHRELNPDEVVALGAAVQANILEGGSKATEDMLLLDVTPLSLGIEALGGVVARIIQRNST IPASATEHFTTGVDGQTNVAIHVLQGERELAKDCRSLARFDLKGIPPMAAGLPRIEVKFLIDANGILQVN AREQRSGQEAQIEVKPTYGLTDDQVESMILESFDFAEQDFHERQLIEARNEATNLLAHVEKAPQHPAWQQ LTEEDRTHIRSLAEELRVLVQGDDLQALRAGTEALDKSTTRFAELMMDAAVSTALRGQTMEAAGDKLGDG PDAPHPFAPAEITDK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGTGAAAACGTTCAGGAAAGAATTGTTGGCATTGATCTCGGTACCACCAACTCGCTGATCGCCTTCATGCAGGGCGAGCAGCCGGT
GGTGATTCCCGGCGAAGACGGCTCCAGGCTTGTGCCTTCGGTCGTGGCTATTCCGTCGGCGAAGCAGATCGTCGTGGGCAACGCCGCACG
GCAATATCTGGCGGAAACGCCGGAGCGCGTCGTCTACTCGGCCAAGCGCCTGATGGGCCGCGGTGTCGAAGATGTGCAGGAAGAGTTGAA
GCTCTTCCCGTTTCGCATCGCCAGTGACCTGCAGACCGGCGAAGTCATCCGCCTGCAGATCGGCGAGCAGCAGTTCACGCCACCGGAGAT
TTCCGCCTACGTCCTGCGCCAGCTCAAGCGTAATGCCGAGCGCTACTTCGGTGCGCCCGTCACCAAGGCGGTCATCACCGTCCCGGCATA
TTTCAATGACGCGCAGCGCCAGGCCACCAAGGATGCAGGCCGCATGGCCGGCCTCGAAGTGCTGCGCCTGGTCAACGAGCCTACGGCGGC
CGCGCTCGCCTACGGCCTCGACCGGGCGAAAGAAGGCATCGTCGCTGTGTACGACCTCGGCGGCGGCACCTTTGATATTTCCATCCTAAA
GCTGCATGACGGCATCTTCGAGGTCATCGCTACCAATGGCGACACCCACCTCGGCGGCGACGACATCGACAACCTGCTCATCGCCATCGC
GCTCGACGACATTCACGGCGAGCTGAATCTCGATCTGCGCCACGACGCTGCGGCCGTGCAGGCCATTCGCAAGGCTGTCATTGAGGCAAA
GATCGCGCTCTCGTCGTCCGATTCCGCCCGCATCTCCGTCGATCTGCCCGGCGGCGTGCCCTATCGCCGTGAAATCACGCGCGAGCAGTT
CCAGCAACTCGTCAAGCCCATCCTCGATCGCACCGTCGGCCCGTGCCTTGCCGCGATGAAAGACGCCGGCATCCAGCCCGAACAAATTGA
TGAAGTCGTCCTTGTCGGCGGCTCCACGCGTATTCCCGCCGTCTGGCAGCTTACCGATGAGCTGTTTCATCTCGCGCCGCGCGGCAAAAA
GCCCCATCGCGAGCTCAATCCCGACGAAGTCGTCGCTCTCGGTGCGGCCGTGCAGGCCAACATTCTTGAGGGCGGCAGCAAAGCCACTGA
GGACATGCTGCTGCTCGACGTCACCCCGCTCTCGCTCGGCATTGAGGCCCTCGGCGGAGTCGTCGCCAGGATCATCCAGCGCAACTCGAC
CATCCCCGCCTCGGCCACCGAGCACTTCACCACCGGCGTCGATGGCCAGACCAACGTTGCCATCCACGTGCTGCAGGGCGAGCGTGAGCT
CGCCAAGGACTGCCGCTCACTCGCCCGCTTCGATCTCAAAGGCATTCCGCCCATGGCCGCCGGTCTGCCGCGCATTGAGGTCAAGTTCCT
CATCGACGCGAACGGCATTCTGCAGGTCAACGCGCGCGAACAGCGCAGTGGACAAGAGGCGCAGATCGAGGTCAAGCCCACCTACGGCCT
CACCGACGATCAGGTGGAGTCGATGATTCTCGAATCCTTCGACTTTGCCGAGCAGGACTTTCATGAGCGCCAGTTGATTGAGGCGCGCAA
TGAGGCCACCAATTTGCTCGCGCACGTGGAGAAGGCACCCCAACACCCCGCCTGGCAACAGTTGACGGAGGAAGACCGCACGCACATTCG
CTCTCTGGCAGAAGAACTCCGCGTGCTCGTGCAGGGCGATGATCTGCAGGCGCTGCGTGCCGGCACCGAGGCGCTCGACAAATCCACCAC
CCGCTTTGCCGAACTTATGATGGATGCCGCCGTCTCCACCGCCCTCCGCGGACAGACCATGGAGGCCGCCGGCGACAAACTTGGTGACGG
CCCGGACGCACCGCACCCCTTTGCGCCTGCCGAAATCACCGACAAATAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine37920 %
Guanine55829 %
Thyamine33818 %
Cytosine66335 %
A+T71737 %
G+C122164 %

Total Bases :   1938 bases

Microsatellites
SequencePosition LengthRepeats
CGGCGGCGG59633
CGCGCG88623
CGCGCG106623
TGCTGCTGC117433
CGCGCGCG146924
GCGCGC161123
CTCTCT170923

Microsatellite Map

ATGAGTGAAAACGTTCAGGAAAGAATTGTTGGCATTGATCTCGGTACCACCAACTCGCTGATCGCCTTCATGCAGGGCGAGCAGCCGGTG
GTGATTCCCGGCGAAGACGGCTCCAGGCTTGTGCCTTCGGTCGTGGCTATTCCGTCGGCGAAGCAGATCGTCGTGGGCAACGCCGCACGG
CAATATCTGGCGGAAACGCCGGAGCGCGTCGTCTACTCGGCCAAGCGCCTGATGGGCCGCGGTGTCGAAGATGTGCAGGAAGAGTTGAAG
CTCTTCCCGTTTCGCATCGCCAGTGACCTGCAGACCGGCGAAGTCATCCGCCTGCAGATCGGCGAGCAGCAGTTCACGCCACCGGAGATT
TCCGCCTACGTCCTGCGCCAGCTCAAGCGTAATGCCGAGCGCTACTTCGGTGCGCCCGTCACCAAGGCGGTCATCACCGTCCCGGCATAT
TTCAATGACGCGCAGCGCCAGGCCACCAAGGATGCAGGCCGCATGGCCGGCCTCGAAGTGCTGCGCCTGGTCAACGAGCCTACGGCGGCC
GCGCTCGCCTACGGCCTCGACCGGGCGAAAGAAGGCATCGTCGCTGTGTACGACCTCGGCGGCGGCACCTTTGATATTTCCATCCTAAAG
CTGCATGACGGCATCTTCGAGGTCATCGCTACCAATGGCGACACCCACCTCGGCGGCGACGACATCGACAACCTGCTCATCGCCATCGCG
CTCGACGACATTCACGGCGAGCTGAATCTCGATCTGCGCCACGACGCTGCGGCCGTGCAGGCCATTCGCAAGGCTGTCATTGAGGCAAAG
ATCGCGCTCTCGTCGTCCGATTCCGCCCGCATCTCCGTCGATCTGCCCGGCGGCGTGCCCTATCGCCGTGAAATCACGCGCGAGCAGTTC
CAGCAACTCGTCAAGCCCATCCTCGATCGCACCGTCGGCCCGTGCCTTGCCGCGATGAAAGACGCCGGCATCCAGCCCGAACAAATTGAT
GAAGTCGTCCTTGTCGGCGGCTCCACGCGTATTCCCGCCGTCTGGCAGCTTACCGATGAGCTGTTTCATCTCGCGCCGCGCGGCAAAAAG
CCCCATCGCGAGCTCAATCCCGACGAAGTCGTCGCTCTCGGTGCGGCCGTGCAGGCCAACATTCTTGAGGGCGGCAGCAAAGCCACTGAG
GACATGCTGCTGCTCGACGTCACCCCGCTCTCGCTCGGCATTGAGGCCCTCGGCGGAGTCGTCGCCAGGATCATCCAGCGCAACTCGACC
ATCCCCGCCTCGGCCACCGAGCACTTCACCACCGGCGTCGATGGCCAGACCAACGTTGCCATCCACGTGCTGCAGGGCGAGCGTGAGCTC
GCCAAGGACTGCCGCTCACTCGCCCGCTTCGATCTCAAAGGCATTCCGCCCATGGCCGCCGGTCTGCCGCGCATTGAGGTCAAGTTCCTC
ATCGACGCGAACGGCATTCTGCAGGTCAACGCGCGCGAACAGCGCAGTGGACAAGAGGCGCAGATCGAGGTCAAGCCCACCTACGGCCTC
ACCGACGATCAGGTGGAGTCGATGATTCTCGAATCCTTCGACTTTGCCGAGCAGGACTTTCATGAGCGCCAGTTGATTGAGGCGCGCAAT
GAGGCCACCAATTTGCTCGCGCACGTGGAGAAGGCACCCCAACACCCCGCCTGGCAACAGTTGACGGAGGAAGACCGCACGCACATTCGC
TCTCTGGCAGAAGAACTCCGCGTGCTCGTGCAGGGCGATGATCTGCAGGCGCTGCGTGCCGGCACCGAGGCGCTCGACAAATCCACCACC
CGCTTTGCCGAACTTATGATGGATGCCGCCGTCTCCACCGCCCTCCGCGGACAGACCATGGAGGCCGCCGGCGACAAACTTGGTGACGGC
CCGGACGCACCGCACCCCTTTGCGCCTGCCGAAATCACCGACAAATAG

Gene Information
Molecule Type genomic DNA
Bases 1938 Bases
Molecular Weight596889.75 Da
Coding Sequence CP001472.1:2954006..2955943
NCBI ReferenceACO31984
Notesidentified by match to protein family HMM PF00012;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 9 to 390 382 N-terminal nucleotide/ATP binding domain PF00012
Linker 391 to 397 7 Linker region Manually identified
Substrate Binding Domain 398 to 608 211 C-terminal substrate/peptide binding domain PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACCA2

Accession Number

HSP70_0010

Added on

2012-02-02

Updated On

2014-01-20