Help  Custom Search
 
chaperone protein DnaK of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone protein DnaK

Synonymous Names

DNAK_ACIC5, Heat shock protein 70, Heat shock 70 kDa protein, DnaK, HSP70

Gene names

Gene Name

dnaK

Gene Locus Tag

ACP_0797

Gene Identifier

7699399

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MAKIIGIDLGTTNSVVAVMEGGEPKVIANEEGGRTTPSVVGFTKSGERLVGQVAKRQAITNPENTIYSIK RFMGRRQNEVNDEMKMVPYKVKQQGDHIVVEAQGKDYTAPEVSAMILQKLKKAAEDYLGTSVTEAVITVP AYFNDAQRQATKDAGKIAGLDVKRIVNEPTAAALAYGLDKKKDETIAVYDFGGGTFDISILEVGEGVIEV KSTNGDTHLGGDNLDQKIVDWLIDEFKKDEGLDLRAKGNEMALQRLKDAAERAKIELSTALETEINLPFI TADATGPKHLVKKLTRAKLEQLVEDILQRSIEPCKKAMADAGVDASKIDEVVLVGGQTRMPRIQEIVKQL FGKEPHRGVNPDEVVAIGAAVQAGVLAGEVKDLLLLDVTPLTLSIETLGGVATPMIPRNTTIPTKKTETF STAGDSQTEVEVHVLQGERPMAGQNRTLGKFKLSGIPPAPRGVPQIEVTFDIDANGILNVTAKDTATGKD QKITITSSSGLSKEEVERMAKEAEAHSAEDKAKRDEIEARNQLDNLVYNIEKMLKENGDKVSGEEKAEVE TALADAKKTLEGTPTAEELNAAREKLTASSHKLAEAMYKANAAAGAAPAGEPAPGEPQAEQKKDDGVIDA EYVDVDEKK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAAAGATTATTGGAATTGACCTCGGAACCACCAATTCCGTGGTGGCCGTGATGGAAGGCGGCGAACCGAAGGTGATCGCCAACGA
AGAGGGCGGCCGCACCACGCCTTCGGTGGTGGGATTTACCAAGAGCGGCGAGCGTCTGGTGGGCCAGGTGGCCAAGCGCCAGGCGATTAC
CAATCCGGAGAACACGATTTACTCCATCAAGCGCTTCATGGGCCGCCGCCAGAATGAAGTGAACGACGAAATGAAGATGGTGCCCTACAA
GGTCAAGCAGCAGGGCGACCACATCGTCGTCGAGGCGCAGGGCAAGGACTACACCGCCCCCGAAGTTTCGGCCATGATTCTGCAGAAGCT
CAAGAAGGCCGCCGAAGACTACCTGGGCACCTCGGTGACCGAGGCCGTCATCACGGTTCCGGCCTACTTTAACGACGCGCAGCGCCAGGC
CACCAAGGACGCCGGCAAAATTGCCGGGCTCGACGTCAAGCGCATCGTCAACGAGCCGACCGCGGCCGCGCTGGCCTATGGCCTCGACAA
GAAGAAGGACGAGACCATCGCCGTATATGACTTTGGCGGCGGTACGTTCGACATCTCCATTCTCGAAGTGGGCGAAGGCGTCATCGAGGT
GAAGTCGACCAATGGCGACACACACCTGGGCGGCGACAACCTCGACCAGAAGATCGTGGACTGGCTCATCGACGAGTTCAAGAAGGACGA
AGGCCTCGACCTGCGCGCCAAGGGCAACGAAATGGCCCTGCAGCGCCTGAAGGACGCCGCCGAGCGCGCCAAGATCGAGCTTTCGACCGC
GCTTGAAACCGAGATCAACCTGCCCTTCATCACCGCCGATGCAACCGGCCCCAAGCACCTGGTGAAGAAGTTGACCCGCGCCAAGCTGGA
GCAGCTCGTCGAGGACATTCTGCAGCGCTCCATTGAGCCCTGCAAGAAGGCCATGGCCGATGCCGGTGTGGACGCGAGCAAGATTGACGA
AGTGGTGCTGGTAGGCGGACAGACCCGCATGCCCCGCATTCAGGAGATCGTCAAGCAGCTCTTTGGCAAGGAGCCCCATCGCGGCGTGAA
CCCCGATGAAGTGGTGGCGATTGGCGCGGCCGTGCAGGCGGGCGTCCTGGCCGGTGAGGTCAAGGATCTGCTGCTGCTCGACGTGACGCC
GCTGACCCTGTCCATCGAAACGCTGGGCGGCGTGGCGACGCCGATGATTCCGCGCAACACGACCATCCCGACCAAGAAGACGGAGACCTT
CTCGACGGCGGGTGACAGCCAGACCGAAGTCGAAGTACACGTGCTGCAGGGCGAGCGCCCCATGGCCGGGCAGAACCGCACGCTGGGCAA
GTTCAAGCTGAGCGGCATTCCTCCGGCGCCGCGCGGCGTGCCGCAGATCGAGGTCACCTTTGACATCGACGCCAACGGCATTCTGAACGT
GACCGCGAAGGATACGGCCACCGGCAAGGACCAGAAGATCACCATCACCTCCTCCTCGGGACTCAGCAAGGAAGAGGTGGAGCGCATGGC
CAAGGAAGCCGAGGCGCACTCGGCCGAAGACAAGGCCAAGCGCGACGAGATCGAGGCCCGCAACCAGCTCGACAACCTCGTCTACAACAT
CGAGAAGATGCTGAAGGAGAACGGCGACAAGGTTTCGGGTGAGGAGAAGGCCGAAGTGGAGACCGCCCTGGCTGACGCCAAGAAGACGCT
CGAAGGCACTCCGACGGCCGAGGAACTGAACGCCGCGCGCGAGAAGCTGACCGCCTCTTCGCACAAGCTGGCCGAGGCCATGTACAAGGC
CAACGCCGCTGCCGGCGCGGCTCCCGCGGGCGAACCTGCCCCCGGCGAACCGCAGGCCGAGCAGAAGAAGGACGACGGCGTGATCGACGC
CGAGTACGTGGACGTGGACGAGAAGAAGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine45424 %
Guanine62033 %
Thyamine25814 %
Cytosine58831 %
A+T71238 %
G+C120863 %

Total Bases :   1920 bases

Microsatellites
SequencePosition LengthRepeats
GCCGCCGCC22033
TCGTCGTCG29233
AAGAAGAAG53733
ACACACAC64624
GCGCGC73123
GCGCGC78223
CTGCTGCTG114633
CGCGCG137823
CCTCCTCCT148633
CGCGCGCG174224

Microsatellite Map

ATGGCAAAGATTATTGGAATTGACCTCGGAACCACCAATTCCGTGGTGGCCGTGATGGAAGGCGGCGAACCGAAGGTGATCGCCAACGAA
GAGGGCGGCCGCACCACGCCTTCGGTGGTGGGATTTACCAAGAGCGGCGAGCGTCTGGTGGGCCAGGTGGCCAAGCGCCAGGCGATTACC
AATCCGGAGAACACGATTTACTCCATCAAGCGCTTCATGGGCCGCCGCCAGAATGAAGTGAACGACGAAATGAAGATGGTGCCCTACAAG
GTCAAGCAGCAGGGCGACCACATCGTCGTCGAGGCGCAGGGCAAGGACTACACCGCCCCCGAAGTTTCGGCCATGATTCTGCAGAAGCTC
AAGAAGGCCGCCGAAGACTACCTGGGCACCTCGGTGACCGAGGCCGTCATCACGGTTCCGGCCTACTTTAACGACGCGCAGCGCCAGGCC
ACCAAGGACGCCGGCAAAATTGCCGGGCTCGACGTCAAGCGCATCGTCAACGAGCCGACCGCGGCCGCGCTGGCCTATGGCCTCGACAAG
AAGAAGGACGAGACCATCGCCGTATATGACTTTGGCGGCGGTACGTTCGACATCTCCATTCTCGAAGTGGGCGAAGGCGTCATCGAGGTG
AAGTCGACCAATGGCGACACACACCTGGGCGGCGACAACCTCGACCAGAAGATCGTGGACTGGCTCATCGACGAGTTCAAGAAGGACGAA
GGCCTCGACCTGCGCGCCAAGGGCAACGAAATGGCCCTGCAGCGCCTGAAGGACGCCGCCGAGCGCGCCAAGATCGAGCTTTCGACCGCG
CTTGAAACCGAGATCAACCTGCCCTTCATCACCGCCGATGCAACCGGCCCCAAGCACCTGGTGAAGAAGTTGACCCGCGCCAAGCTGGAG
CAGCTCGTCGAGGACATTCTGCAGCGCTCCATTGAGCCCTGCAAGAAGGCCATGGCCGATGCCGGTGTGGACGCGAGCAAGATTGACGAA
GTGGTGCTGGTAGGCGGACAGACCCGCATGCCCCGCATTCAGGAGATCGTCAAGCAGCTCTTTGGCAAGGAGCCCCATCGCGGCGTGAAC
CCCGATGAAGTGGTGGCGATTGGCGCGGCCGTGCAGGCGGGCGTCCTGGCCGGTGAGGTCAAGGATCTGCTGCTGCTCGACGTGACGCCG
CTGACCCTGTCCATCGAAACGCTGGGCGGCGTGGCGACGCCGATGATTCCGCGCAACACGACCATCCCGACCAAGAAGACGGAGACCTTC
TCGACGGCGGGTGACAGCCAGACCGAAGTCGAAGTACACGTGCTGCAGGGCGAGCGCCCCATGGCCGGGCAGAACCGCACGCTGGGCAAG
TTCAAGCTGAGCGGCATTCCTCCGGCGCCGCGCGGCGTGCCGCAGATCGAGGTCACCTTTGACATCGACGCCAACGGCATTCTGAACGTG
ACCGCGAAGGATACGGCCACCGGCAAGGACCAGAAGATCACCATCACCTCCTCCTCGGGACTCAGCAAGGAAGAGGTGGAGCGCATGGCC
AAGGAAGCCGAGGCGCACTCGGCCGAAGACAAGGCCAAGCGCGACGAGATCGAGGCCCGCAACCAGCTCGACAACCTCGTCTACAACATC
GAGAAGATGCTGAAGGAGAACGGCGACAAGGTTTCGGGTGAGGAGAAGGCCGAAGTGGAGACCGCCCTGGCTGACGCCAAGAAGACGCTC
GAAGGCACTCCGACGGCCGAGGAACTGAACGCCGCGCGCGAGAAGCTGACCGCCTCTTCGCACAAGCTGGCCGAGGCCATGTACAAGGCC
AACGCCGCTGCCGGCGCGGCTCCCGCGGGCGAACCTGCCCCCGGCGAACCGCAGGCCGAGCAGAAGAAGGACGACGGCGTGATCGACGCC
GAGTACGTGGACGTGGACGAGAAGAAGTAA

Gene Information
Molecule Type genomic DNA
Bases 1920 Bases
Molecular Weight594767.02 Da
Coding Sequence CP001472.1:916828..918747
NCBI ReferenceACO33100
Notesidentified by match to protein family HMM PF00012;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 381 378 N-terminal nucleotide/ATP binding domain PF00012
Linker 382 to 388 7 Linker region Manually identified
Substrate Binding Domain 389 to 599 211 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 246 to 273 28 Coiled coil region Manually identified
Coiled coil 501 to 530 31 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACCA1

Accession Number

HSP70_0009

Added on

2012-02-02

Updated On

2014-01-20