Help  Custom Search
 
Fe-S protein assembly chaperone hscA of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Fe-S protein assembly chaperone hscA

Synonymous Names

HSCA_ACIF5, HSP70, HscA, chaperone protein hscA homolog

Gene names

Gene Name

hscA

Gene Locus Tag

Lferr_0826

Gene Identifier

6876791

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MALMQIAEPGTAADPHQRRLAIGIDLGTTHSLVASVLSAVPTVMRDHDGKYLLPSVVRYLGGGGIHVGYP AVAAAGQDPHNTIASAKRLMGRGHGDVQTLAGHLPYDLVPGEGMVRLRTVAGEKSPVEVSAEILRVLKER AVETLGGEPEGAVITVPAYFDEAQRQATKDAARLAGLNVLRLLAEPTAAAVAYGLDKGSEGIFAIYDLGG GTFDISILRLQAGVFEVLATAGDSALGGDDMDHALAEWLMQEEGGDASDPLWRRQVLQQARTAKEALSAV AETMIVLTPSGRAAREIKLSRGRLESLIQPVIQRSLPACRRALRDAGLKLDEIEGVVLVGGATRVPAVRA MVEEFFRQKPLTDIDPDQVVAIGAAIQADALVGNQREDLLLMDVLPLSLGLETMGGLVEKIIPRNTPIPV ARAQEFTTFKDGQTAMSIHVVQGERDLVQDCRSLARFSLRGIPPMVAGAARIRVTFQVDADGLLAVRAEE TSTGVRSEVVVKPSYGLNDEEIARMLQDSFIHGAEDVVRRRLSEAKVEGERVREALRTALAADADLLDPA EREALDKAGTALTNALSGDDAGVITAAAEAVETAAEPLVQRRMDSALRRAITGRSIDELGD

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCGTTAATGCAAATTGCAGAACCGGGCACGGCCGCTGATCCCCATCAGCGGCGGCTGGCTATCGGTATCGACCTGGGAACCACCCA
TTCGCTGGTGGCCTCCGTATTGTCGGCGGTGCCCACCGTCATGCGCGATCATGACGGTAAATATCTCCTGCCTTCGGTGGTGCGCTACCT
CGGCGGCGGCGGTATTCATGTAGGCTATCCCGCGGTCGCTGCCGCCGGGCAGGACCCGCACAATACCATCGCCTCGGCGAAACGCCTGAT
GGGGCGCGGCCACGGCGATGTGCAAACCCTCGCCGGGCACCTACCTTACGACCTTGTTCCTGGAGAGGGTATGGTGCGCCTGCGTACAGT
GGCGGGTGAAAAATCCCCCGTAGAGGTGTCTGCCGAAATATTGCGGGTGCTCAAAGAGCGGGCGGTGGAAACCCTGGGTGGCGAACCGGA
GGGCGCGGTGATCACGGTGCCCGCTTATTTCGACGAGGCCCAGCGTCAGGCCACCAAAGATGCGGCCCGTCTGGCGGGACTGAACGTGTT
GCGTCTACTGGCCGAGCCGACCGCGGCGGCGGTGGCCTATGGCTTGGACAAGGGCAGTGAAGGCATTTTTGCCATCTACGATCTGGGCGG
CGGAACCTTCGATATTTCCATATTGCGCCTGCAGGCCGGAGTCTTTGAGGTGCTGGCGACCGCCGGTGATTCCGCCCTGGGCGGTGACGA
TATGGATCATGCGCTGGCCGAATGGCTGATGCAGGAGGAGGGCGGCGATGCGTCCGATCCCCTCTGGCGGCGGCAGGTGCTGCAGCAGGC
GCGTACCGCCAAGGAGGCGCTCAGTGCCGTTGCTGAAACGATGATAGTGCTGACGCCTTCCGGTCGCGCGGCCCGCGAGATAAAACTGTC
GCGTGGCCGGTTGGAGTCACTGATTCAGCCGGTGATCCAGCGGTCCCTCCCGGCTTGTCGGCGGGCGCTGCGGGATGCCGGTTTAAAGCT
GGATGAGATTGAAGGCGTGGTGCTGGTGGGCGGCGCCACCCGTGTCCCCGCCGTGCGCGCGATGGTGGAGGAATTCTTTCGGCAGAAGCC
GCTGACGGACATCGACCCCGATCAGGTGGTGGCCATAGGGGCCGCCATTCAGGCCGATGCCCTGGTAGGCAATCAGCGTGAAGATTTGCT
GCTCATGGACGTGCTGCCGCTGTCCCTTGGTCTGGAGACCATGGGCGGACTGGTGGAGAAAATCATTCCCCGCAATACCCCTATTCCGGT
GGCACGGGCGCAGGAGTTCACCACCTTCAAGGATGGTCAGACGGCCATGAGTATTCACGTCGTGCAGGGGGAGCGCGATCTGGTGCAGGA
CTGTCGTTCTCTGGCGCGTTTCAGTCTGCGCGGCATTCCCCCCATGGTGGCCGGTGCCGCAAGGATTCGCGTGACTTTTCAGGTGGACGC
CGATGGCCTGCTGGCGGTGCGTGCAGAGGAAACCAGTACGGGGGTGCGTTCGGAAGTCGTCGTCAAACCGTCTTACGGTCTGAATGATGA
AGAAATCGCCAGGATGTTGCAGGACTCGTTCATCCATGGCGCCGAAGACGTGGTCAGAAGACGCCTGTCAGAAGCCAAAGTGGAGGGTGA
GCGCGTACGCGAAGCCTTGCGTACGGCTTTGGCCGCCGATGCCGACCTGCTGGATCCGGCGGAGCGGGAAGCCCTGGACAAGGCCGGTAC
CGCGTTGACCAACGCCTTGTCGGGTGACGACGCCGGCGTGATCACGGCCGCCGCGGAGGCGGTGGAAACCGCCGCAGAACCGCTGGTGCA
ACGGCGTATGGACAGTGCCCTACGCCGCGCCATCACTGGCCGTTCCATTGACGAACTGGGAGACTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine32618 %
Guanine65035 %
Thyamine35520 %
Cytosine53529 %
A+T68137 %
G+C118564 %

Total Bases :   1866 bases

Microsatellites
SequencePosition LengthRepeats
CGGCGGCGGCGG17934
GCGGCGGCG56133
AGGAGGAGG75133
GGCGGCGGC78433
CGCGCG87323
GCGCGC104323
CCCCCC138623
GTCGTCGTC149433

Microsatellite Map

ATGGCGTTAATGCAAATTGCAGAACCGGGCACGGCCGCTGATCCCCATCAGCGGCGGCTGGCTATCGGTATCGACCTGGGAACCACCCAT
TCGCTGGTGGCCTCCGTATTGTCGGCGGTGCCCACCGTCATGCGCGATCATGACGGTAAATATCTCCTGCCTTCGGTGGTGCGCTACCTC
GGCGGCGGCGGTATTCATGTAGGCTATCCCGCGGTCGCTGCCGCCGGGCAGGACCCGCACAATACCATCGCCTCGGCGAAACGCCTGATG
GGGCGCGGCCACGGCGATGTGCAAACCCTCGCCGGGCACCTACCTTACGACCTTGTTCCTGGAGAGGGTATGGTGCGCCTGCGTACAGTG
GCGGGTGAAAAATCCCCCGTAGAGGTGTCTGCCGAAATATTGCGGGTGCTCAAAGAGCGGGCGGTGGAAACCCTGGGTGGCGAACCGGAG
GGCGCGGTGATCACGGTGCCCGCTTATTTCGACGAGGCCCAGCGTCAGGCCACCAAAGATGCGGCCCGTCTGGCGGGACTGAACGTGTTG
CGTCTACTGGCCGAGCCGACCGCGGCGGCGGTGGCCTATGGCTTGGACAAGGGCAGTGAAGGCATTTTTGCCATCTACGATCTGGGCGGC
GGAACCTTCGATATTTCCATATTGCGCCTGCAGGCCGGAGTCTTTGAGGTGCTGGCGACCGCCGGTGATTCCGCCCTGGGCGGTGACGAT
ATGGATCATGCGCTGGCCGAATGGCTGATGCAGGAGGAGGGCGGCGATGCGTCCGATCCCCTCTGGCGGCGGCAGGTGCTGCAGCAGGCG
CGTACCGCCAAGGAGGCGCTCAGTGCCGTTGCTGAAACGATGATAGTGCTGACGCCTTCCGGTCGCGCGGCCCGCGAGATAAAACTGTCG
CGTGGCCGGTTGGAGTCACTGATTCAGCCGGTGATCCAGCGGTCCCTCCCGGCTTGTCGGCGGGCGCTGCGGGATGCCGGTTTAAAGCTG
GATGAGATTGAAGGCGTGGTGCTGGTGGGCGGCGCCACCCGTGTCCCCGCCGTGCGCGCGATGGTGGAGGAATTCTTTCGGCAGAAGCCG
CTGACGGACATCGACCCCGATCAGGTGGTGGCCATAGGGGCCGCCATTCAGGCCGATGCCCTGGTAGGCAATCAGCGTGAAGATTTGCTG
CTCATGGACGTGCTGCCGCTGTCCCTTGGTCTGGAGACCATGGGCGGACTGGTGGAGAAAATCATTCCCCGCAATACCCCTATTCCGGTG
GCACGGGCGCAGGAGTTCACCACCTTCAAGGATGGTCAGACGGCCATGAGTATTCACGTCGTGCAGGGGGAGCGCGATCTGGTGCAGGAC
TGTCGTTCTCTGGCGCGTTTCAGTCTGCGCGGCATTCCCCCCATGGTGGCCGGTGCCGCAAGGATTCGCGTGACTTTTCAGGTGGACGCC
GATGGCCTGCTGGCGGTGCGTGCAGAGGAAACCAGTACGGGGGTGCGTTCGGAAGTCGTCGTCAAACCGTCTTACGGTCTGAATGATGAA
GAAATCGCCAGGATGTTGCAGGACTCGTTCATCCATGGCGCCGAAGACGTGGTCAGAAGACGCCTGTCAGAAGCCAAAGTGGAGGGTGAG
CGCGTACGCGAAGCCTTGCGTACGGCTTTGGCCGCCGATGCCGACCTGCTGGATCCGGCGGAGCGGGAAGCCCTGGACAAGGCCGGTACC
GCGTTGACCAACGCCTTGTCGGGTGACGACGCCGGCGTGATCACGGCCGCCGCGGAGGCGGTGGAAACCGCCGCAGAACCGCTGGTGCAA
CGGCGTATGGACAGTGCCCTACGCCGCGCCATCACTGGCCGTTCCATTGACGAACTGGGAGACTGA

Gene Information
Molecule Type genomic DNA
Bases 1866 Bases
Molecular Weight578733.3 Da
Coding Sequence CP001132.1:783646..785511
NCBI ReferenceACH83076
NotesKEGG: bvi:Bcep1808_2201 chaperone protein HscA;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 21 to 387 367 N-terminal nucleotide/ATP binding domain PF00012
Linker 388 to 395 8 Linker region Manually identified
Substrate Binding Domain 396 to 604 209 C-terminal substrate/peptide binding domain PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACFE2

Accession Number

HSP70_0008

Added on

2012-02-02

Updated On

2014-01-20