Help  Custom Search
 
chaperone protein DnaK of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone protein DnaK

Synonymous Names

DNAK_ACIF5, Heat shock protein 70, Heat shock 70 kDa protein, HSP70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

Lferr_2291

Gene Identifier

6878285

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MAKVIGIDLGTTNSCVAVMEGDKVKVIENSEGKRTTPSIVAITEEGEVLVGEAAKRQAVTNPENTVYEVK RLIGRKFDDAEVQKDLKHVPYKVIKADNGDAWVEVRDKKYSAQQISAFILQKMKKTAEDYLGEKVTEAVI TVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAFGEDKKPGDSKIAVYDLGGGTFDISIIEIAEM EGEHQFEVLSTNGDTFLGGGDFDSRVINYLADSFKAESGIDLRGDRLAMQRLKEAAEKAKIELSSAQQTD VNLPFITADQSGPKHLNMKLTRAKLESLVEDLIDRSMAPCRVAMKDANLATSRITDVILVGGQSRMPKVQ EKVKDFFGQDPRKDVNPDEAVAIGAAIQGAVLSGEKKDVLLMDVTPLSLGIETLGGVMTKLIEKNTTIPT RKSQIFSTAEDNQSAVTVHVLQGERELARDNKSLARFDLTDIANAPRGMPQIEVTFDIDANGILHVSAKD NQTGKEQSIKITASSGLSEEEIKRMIQEAEAHAADDKKARALIEARNEADASVHGARKAVEEHAAAPEHD KTKVTEAISAVENAAKGEDVEAIKGAVATLMAAMSALLQSAAAGQAQAESGAGAQGNAKPDDVVDAEFEE VDKK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTAAAGTGATCGGAATTGATTTGGGAACCACCAACTCCTGCGTTGCCGTGATGGAAGGCGACAAGGTCAAGGTGATCGAGAACAG
CGAAGGCAAGCGCACCACGCCGTCTATCGTCGCCATCACCGAAGAGGGCGAAGTGTTGGTGGGTGAAGCGGCCAAGCGCCAGGCCGTCAC
CAATCCGGAAAATACCGTTTATGAGGTCAAACGCCTGATCGGCCGCAAGTTCGACGATGCCGAGGTCCAGAAGGATCTCAAGCATGTGCC
TTACAAGGTCATCAAGGCCGACAACGGCGACGCCTGGGTGGAAGTGCGCGATAAGAAGTATTCCGCGCAGCAGATTTCTGCCTTCATCCT
GCAGAAGATGAAGAAGACGGCCGAAGATTATCTTGGTGAAAAAGTCACCGAAGCGGTCATCACCGTACCCGCCTACTTCAACGATGCACA
GCGTCAGGCGACCAAGGATGCGGGCCGTATCGCTGGTCTGGAGGTCAAGCGCATCATCAATGAACCCACTGCGGCGGCGCTGGCCTTTGG
CGAAGACAAGAAGCCCGGCGACAGCAAAATTGCGGTGTATGACCTGGGTGGCGGCACCTTCGACATCTCCATCATCGAGATCGCTGAAAT
GGAGGGTGAACACCAGTTTGAAGTGCTCTCCACCAATGGTGACACCTTCCTCGGTGGCGGTGATTTTGACTCCCGCGTCATCAACTACCT
GGCAGATTCCTTCAAAGCGGAATCGGGTATCGATCTGCGCGGCGACCGTCTGGCCATGCAGCGCCTGAAGGAAGCTGCGGAGAAGGCGAA
GATCGAGTTGTCTTCGGCGCAGCAGACCGACGTCAATCTGCCCTTTATCACGGCGGATCAGAGCGGGCCGAAGCATCTGAACATGAAGCT
GACCCGCGCCAAACTGGAGTCGCTGGTGGAAGATTTGATCGACCGCAGCATGGCGCCCTGCCGAGTGGCCATGAAGGACGCCAATCTGGC
GACGAGCCGGATCACCGACGTGATTCTGGTGGGCGGCCAGAGCCGGATGCCCAAGGTGCAGGAGAAGGTCAAAGACTTCTTCGGTCAGGA
TCCGCGTAAGGATGTGAACCCTGACGAGGCAGTGGCCATCGGTGCGGCCATCCAGGGCGCGGTGTTGTCCGGTGAAAAGAAAGACGTGCT
GTTGATGGATGTGACGCCGTTGTCCCTTGGCATCGAGACCCTGGGTGGCGTGATGACCAAGCTGATCGAGAAGAACACCACCATCCCGAC
CCGCAAGTCGCAGATTTTCTCGACGGCGGAAGATAACCAGTCGGCGGTGACGGTGCATGTGTTGCAGGGTGAGCGCGAACTGGCGCGGGA
TAACAAGTCCCTGGCGCGTTTTGATCTGACCGATATTGCCAACGCCCCACGGGGCATGCCGCAGATCGAAGTGACCTTCGACATCGACGC
CAACGGTATCCTCCATGTCTCGGCCAAGGACAATCAGACCGGCAAGGAGCAGTCCATCAAGATCACCGCAAGCTCTGGTCTGTCCGAGGA
AGAAATCAAGCGGATGATTCAGGAGGCCGAGGCCCACGCTGCGGATGACAAGAAGGCGCGTGCGCTGATCGAGGCACGTAACGAGGCGGA
CGCCAGCGTGCACGGCGCGCGCAAGGCGGTGGAGGAACATGCCGCGGCACCTGAGCACGACAAGACCAAGGTGACGGAAGCGATCTCCGC
GGTGGAAAACGCCGCCAAGGGTGAGGACGTGGAAGCGATCAAGGGGGCTGTCGCCACTCTGATGGCCGCCATGTCGGCATTGTTGCAGAG
TGCCGCTGCCGGTCAGGCCCAGGCAGAATCCGGTGCGGGTGCCCAGGGCAATGCCAAGCCGGACGACGTGGTGGATGCCGAGTTCGAAGA
AGTCGACAAGAAGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine45524 %
Guanine61333 %
Thyamine32418 %
Cytosine51327 %
A+T77941 %
G+C112660 %

Total Bases :   1905 bases

Microsatellites
SequencePosition LengthRepeats
GCGGCGGCG51933
GCGCGCGC163324

Microsatellite Map

ATGGCTAAAGTGATCGGAATTGATTTGGGAACCACCAACTCCTGCGTTGCCGTGATGGAAGGCGACAAGGTCAAGGTGATCGAGAACAGC
GAAGGCAAGCGCACCACGCCGTCTATCGTCGCCATCACCGAAGAGGGCGAAGTGTTGGTGGGTGAAGCGGCCAAGCGCCAGGCCGTCACC
AATCCGGAAAATACCGTTTATGAGGTCAAACGCCTGATCGGCCGCAAGTTCGACGATGCCGAGGTCCAGAAGGATCTCAAGCATGTGCCT
TACAAGGTCATCAAGGCCGACAACGGCGACGCCTGGGTGGAAGTGCGCGATAAGAAGTATTCCGCGCAGCAGATTTCTGCCTTCATCCTG
CAGAAGATGAAGAAGACGGCCGAAGATTATCTTGGTGAAAAAGTCACCGAAGCGGTCATCACCGTACCCGCCTACTTCAACGATGCACAG
CGTCAGGCGACCAAGGATGCGGGCCGTATCGCTGGTCTGGAGGTCAAGCGCATCATCAATGAACCCACTGCGGCGGCGCTGGCCTTTGGC
GAAGACAAGAAGCCCGGCGACAGCAAAATTGCGGTGTATGACCTGGGTGGCGGCACCTTCGACATCTCCATCATCGAGATCGCTGAAATG
GAGGGTGAACACCAGTTTGAAGTGCTCTCCACCAATGGTGACACCTTCCTCGGTGGCGGTGATTTTGACTCCCGCGTCATCAACTACCTG
GCAGATTCCTTCAAAGCGGAATCGGGTATCGATCTGCGCGGCGACCGTCTGGCCATGCAGCGCCTGAAGGAAGCTGCGGAGAAGGCGAAG
ATCGAGTTGTCTTCGGCGCAGCAGACCGACGTCAATCTGCCCTTTATCACGGCGGATCAGAGCGGGCCGAAGCATCTGAACATGAAGCTG
ACCCGCGCCAAACTGGAGTCGCTGGTGGAAGATTTGATCGACCGCAGCATGGCGCCCTGCCGAGTGGCCATGAAGGACGCCAATCTGGCG
ACGAGCCGGATCACCGACGTGATTCTGGTGGGCGGCCAGAGCCGGATGCCCAAGGTGCAGGAGAAGGTCAAAGACTTCTTCGGTCAGGAT
CCGCGTAAGGATGTGAACCCTGACGAGGCAGTGGCCATCGGTGCGGCCATCCAGGGCGCGGTGTTGTCCGGTGAAAAGAAAGACGTGCTG
TTGATGGATGTGACGCCGTTGTCCCTTGGCATCGAGACCCTGGGTGGCGTGATGACCAAGCTGATCGAGAAGAACACCACCATCCCGACC
CGCAAGTCGCAGATTTTCTCGACGGCGGAAGATAACCAGTCGGCGGTGACGGTGCATGTGTTGCAGGGTGAGCGCGAACTGGCGCGGGAT
AACAAGTCCCTGGCGCGTTTTGATCTGACCGATATTGCCAACGCCCCACGGGGCATGCCGCAGATCGAAGTGACCTTCGACATCGACGCC
AACGGTATCCTCCATGTCTCGGCCAAGGACAATCAGACCGGCAAGGAGCAGTCCATCAAGATCACCGCAAGCTCTGGTCTGTCCGAGGAA
GAAATCAAGCGGATGATTCAGGAGGCCGAGGCCCACGCTGCGGATGACAAGAAGGCGCGTGCGCTGATCGAGGCACGTAACGAGGCGGAC
GCCAGCGTGCACGGCGCGCGCAAGGCGGTGGAGGAACATGCCGCGGCACCTGAGCACGACAAGACCAAGGTGACGGAAGCGATCTCCGCG
GTGGAAAACGCCGCCAAGGGTGAGGACGTGGAAGCGATCAAGGGGGCTGTCGCCACTCTGATGGCCGCCATGTCGGCATTGTTGCAGAGT
GCCGCTGCCGGTCAGGCCCAGGCAGAATCCGGTGCGGGTGCCCAGGGCAATGCCAAGCCGGACGACGTGGTGGATGCCGAGTTCGAAGAA
GTCGACAAGAAGTAA

Gene Information
Molecule Type genomic DNA
Bases 1905 Bases
Molecular Weight591164.46 Da
Coding Sequence complement(CP001132.1:2261812..2263716)
NCBI ReferenceACH84492
NotesKEGG: aeh:Mlg_1900 chaperone protein DnaK; TIGRFAM:

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 387 384 N-terminal nucleotide/ATP binding domain PF00012
Linker 388 to 394 7 Linker region Manually identified
Substrate Binding Domain 395 to 603 209 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 252 to 280 29 Coiled coil region Manually identified
Coiled coil 509 to 530 22 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACFE1

Accession Number

HSP70_0007

Added on

2012-02-02

Updated On

2014-01-20