Help  Custom Search
 
chaperone protein DnaK of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone protein DnaK

Synonymous Names

DNAK_ACICJ, Heat shock 70 kDa protein, Heat shock protein 70, HSP70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

Acry_1646

Gene Identifier

5160770

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MSKVIGIDLGTTNSCVAIMEGKDVRVIENSEGARTTPSMVAFSESNERLVGQSAKRQAVTNPTNTLYAVK RLIGRRYDDPTVEKDKGLVSYNIVRGDNGDAWVESRGQRYAPSQISSFVLTKMKETAEAYLGEAVTQAVI TVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGMDKKQGGTIAVYDLGGGTFDISILELGDGV FEVKSTNGDTFLGGEDFDQRVIDYLAEEFKREQGIDLRKDKLALQRLKEAAEKAKIELSSSKETEINLPF ITADASGPKHLVMKLTRAKLESLVDDLVERTLGPCRAALKDAGVTAGEIDEVILVGGMTRMPKVIETVKT FFGKEPARNVNPDEVVAIGAAIQGAVLKGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQT FSTADDNQTAVTIKVYQGEREMAADNKLLGNFDLTGIPPAPRGVPQIEVTFDIDANGIVSVSAKDKATGK EQQIRIQASGGLSDTDIERMVKDAEANAAADKAKRELVDARNHADGLVHQTEKTLKDNEGKVSAQDKGEA EAAIAAVRSALEGSDLEAIKSATERLTQVAMRIGEAMYKAQAEAGAAQPGAETAAPGDKVVDAEFEDVDD KKKSA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGTAAGGTCATCGGTATCGACCTCGGCACCACGAATTCCTGCGTCGCGATCATGGAGGGCAAGGATGTCCGCGTGATCGAGAACAG
CGAGGGCGCGCGCACGACACCGTCGATGGTCGCCTTCTCCGAGAGCAACGAGCGTCTGGTCGGCCAGTCCGCCAAGCGTCAGGCGGTCAC
CAACCCGACGAACACGCTGTATGCGGTCAAGCGCCTGATCGGCCGCCGCTATGACGATCCCACCGTCGAGAAGGACAAGGGCCTCGTCTC
CTACAACATCGTCCGCGGCGACAATGGCGATGCCTGGGTCGAGTCGCGCGGCCAGCGCTACGCGCCGAGCCAGATCTCGTCCTTCGTGCT
GACCAAGATGAAGGAAACCGCCGAGGCCTATCTCGGCGAAGCCGTGACCCAGGCGGTCATCACCGTCCCGGCCTACTTCAACGACGCCCA
GCGCCAGGCCACCAAGGACGCCGGCAAGATCGCCGGGCTCGAGGTGCTGCGCATCATCAACGAACCGACGGCGGCGGCTCTCGCCTACGG
CATGGACAAGAAGCAGGGCGGCACGATCGCGGTCTACGACCTCGGCGGCGGCACGTTCGACATCTCGATCCTCGAACTGGGCGACGGCGT
GTTCGAGGTGAAGTCCACCAACGGCGACACCTTCCTCGGCGGCGAGGATTTCGACCAGCGCGTGATCGACTACCTGGCCGAGGAGTTCAA
GCGCGAGCAGGGCATCGACCTGCGCAAGGACAAGCTCGCCCTCCAGCGCCTGAAGGAAGCCGCTGAAAAGGCGAAGATCGAGCTGTCCTC
CTCGAAGGAGACCGAGATCAACCTGCCCTTCATCACCGCCGACGCCTCGGGGCCGAAGCATCTCGTGATGAAGCTGACCCGTGCCAAGCT
CGAAAGCCTCGTGGATGATCTGGTCGAGCGCACGCTCGGCCCGTGCCGCGCGGCGCTGAAGGATGCCGGTGTCACCGCCGGCGAGATCGA
CGAGGTGATCCTGGTCGGCGGCATGACCCGCATGCCCAAGGTCATCGAGACGGTGAAGACCTTCTTCGGCAAGGAACCCGCCCGCAACGT
CAACCCCGACGAGGTGGTCGCCATCGGCGCCGCCATCCAGGGCGCGGTGCTCAAGGGCGACGTCAAGGACGTCCTCCTGCTCGACGTCAC
CCCGCTCTCGCTCGGCATCGAGACGCTGGGCGGCGTGTTCACCCGCCTGATCGACCGCAACACCACGATCCCGACCAAGAAGAGCCAGAC
CTTCTCCACCGCCGACGACAACCAGACCGCCGTGACCATCAAGGTCTACCAGGGCGAGCGCGAGATGGCGGCGGACAACAAGCTGCTCGG
CAATTTCGACCTGACCGGCATTCCCCCGGCCCCGCGCGGGGTGCCGCAGATCGAGGTCACCTTCGACATCGACGCCAACGGCATCGTGTC
CGTCTCGGCGAAGGACAAGGCGACCGGCAAGGAGCAGCAGATCCGCATCCAGGCCTCCGGCGGCCTGTCGGACACCGATATCGAGCGCAT
GGTGAAGGACGCCGAGGCGAACGCCGCGGCCGACAAGGCCAAGCGCGAGCTGGTCGATGCCCGCAACCATGCCGACGGCCTCGTCCACCA
GACCGAGAAGACGCTGAAGGACAACGAGGGCAAGGTCTCCGCCCAGGACAAGGGCGAGGCCGAGGCGGCGATCGCCGCGGTGCGCTCCGC
GCTGGAAGGCAGCGATCTCGAGGCGATTAAGTCGGCCACCGAGCGGCTGACCCAGGTCGCCATGCGGATTGGCGAGGCGATGTACAAGGC
GCAGGCCGAGGCCGGTGCCGCCCAGCCGGGCGCCGAGACGGCCGCGCCGGGCGACAAGGTGGTCGACGCCGAATTCGAGGATGTCGACGA
CAAGAAGAAGTCCGCGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine39221 %
Guanine62133 %
Thyamine25114 %
Cytosine64434 %
A+T64334 %
G+C126567 %

Total Bases :   1908 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGCGC9424
CGCGCG31323
CGGCGGCGG51733
CGGCGGCGG58133
CGCGCG94523
CGCGCG138123
AAGAAGAAG189033

Microsatellite Map

ATGAGTAAGGTCATCGGTATCGACCTCGGCACCACGAATTCCTGCGTCGCGATCATGGAGGGCAAGGATGTCCGCGTGATCGAGAACAGC
GAGGGCGCGCGCACGACACCGTCGATGGTCGCCTTCTCCGAGAGCAACGAGCGTCTGGTCGGCCAGTCCGCCAAGCGTCAGGCGGTCACC
AACCCGACGAACACGCTGTATGCGGTCAAGCGCCTGATCGGCCGCCGCTATGACGATCCCACCGTCGAGAAGGACAAGGGCCTCGTCTCC
TACAACATCGTCCGCGGCGACAATGGCGATGCCTGGGTCGAGTCGCGCGGCCAGCGCTACGCGCCGAGCCAGATCTCGTCCTTCGTGCTG
ACCAAGATGAAGGAAACCGCCGAGGCCTATCTCGGCGAAGCCGTGACCCAGGCGGTCATCACCGTCCCGGCCTACTTCAACGACGCCCAG
CGCCAGGCCACCAAGGACGCCGGCAAGATCGCCGGGCTCGAGGTGCTGCGCATCATCAACGAACCGACGGCGGCGGCTCTCGCCTACGGC
ATGGACAAGAAGCAGGGCGGCACGATCGCGGTCTACGACCTCGGCGGCGGCACGTTCGACATCTCGATCCTCGAACTGGGCGACGGCGTG
TTCGAGGTGAAGTCCACCAACGGCGACACCTTCCTCGGCGGCGAGGATTTCGACCAGCGCGTGATCGACTACCTGGCCGAGGAGTTCAAG
CGCGAGCAGGGCATCGACCTGCGCAAGGACAAGCTCGCCCTCCAGCGCCTGAAGGAAGCCGCTGAAAAGGCGAAGATCGAGCTGTCCTCC
TCGAAGGAGACCGAGATCAACCTGCCCTTCATCACCGCCGACGCCTCGGGGCCGAAGCATCTCGTGATGAAGCTGACCCGTGCCAAGCTC
GAAAGCCTCGTGGATGATCTGGTCGAGCGCACGCTCGGCCCGTGCCGCGCGGCGCTGAAGGATGCCGGTGTCACCGCCGGCGAGATCGAC
GAGGTGATCCTGGTCGGCGGCATGACCCGCATGCCCAAGGTCATCGAGACGGTGAAGACCTTCTTCGGCAAGGAACCCGCCCGCAACGTC
AACCCCGACGAGGTGGTCGCCATCGGCGCCGCCATCCAGGGCGCGGTGCTCAAGGGCGACGTCAAGGACGTCCTCCTGCTCGACGTCACC
CCGCTCTCGCTCGGCATCGAGACGCTGGGCGGCGTGTTCACCCGCCTGATCGACCGCAACACCACGATCCCGACCAAGAAGAGCCAGACC
TTCTCCACCGCCGACGACAACCAGACCGCCGTGACCATCAAGGTCTACCAGGGCGAGCGCGAGATGGCGGCGGACAACAAGCTGCTCGGC
AATTTCGACCTGACCGGCATTCCCCCGGCCCCGCGCGGGGTGCCGCAGATCGAGGTCACCTTCGACATCGACGCCAACGGCATCGTGTCC
GTCTCGGCGAAGGACAAGGCGACCGGCAAGGAGCAGCAGATCCGCATCCAGGCCTCCGGCGGCCTGTCGGACACCGATATCGAGCGCATG
GTGAAGGACGCCGAGGCGAACGCCGCGGCCGACAAGGCCAAGCGCGAGCTGGTCGATGCCCGCAACCATGCCGACGGCCTCGTCCACCAG
ACCGAGAAGACGCTGAAGGACAACGAGGGCAAGGTCTCCGCCCAGGACAAGGGCGAGGCCGAGGCGGCGATCGCCGCGGTGCGCTCCGCG
CTGGAAGGCAGCGATCTCGAGGCGATTAAGTCGGCCACCGAGCGGCTGACCCAGGTCGCCATGCGGATTGGCGAGGCGATGTACAAGGCG
CAGGCCGAGGCCGGTGCCGCCCAGCCGGGCGCCGAGACGGCCGCGCCGGGCGACAAGGTGGTCGACGCCGAATTCGAGGATGTCGACGAC
AAGAAGAAGTCCGCGTGA

Gene Information
Molecule Type genomic DNA
Bases 1908 Bases
Molecular Weight589741.89 Da
Coding Sequence complement(CP000697.1:1818260..1820167)
NCBI ReferenceABQ30851
NotesTIGRFAM: chaperone protein DnaK; PFAM: Heat shock

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 382 379 N-terminal nucleotide/ATP binding domain PF00012
Linker 383 to 389 7 Linker region Manually identified
Substrate Binding Domain 390 to 599 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 520 to 540 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACCR1

Accession Number

HSP70_0006

Added on

2012-02-02

Updated On

2014-01-20