Help  Custom Search
 
molecular chaperone DnaK of Acholeplasma laidlawii str. PG-8A

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone DnaK

Synonymous Names

A9NFN8_ACHLI, Hsp70, Heat shock 70 kDa protein, Heat shock protein 70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

ACL_0550

Gene Identifier

5803527

Taxon Information

Organism

Acholeplasma laidlawii str. PG-8A

Organism ID

441768 [NCBI] [UNIPROT]

Lineage

Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Acholeplasma; Acholeplasma laidlawii PG-8A

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MAKTNKIIGIDLGTTNSVVSVMEGNEAKVIPNAEGGRTTPSIVAFKGDEILVGEVAKRQLITNPDTIYSI KRHMGDLNYKVKAAGKEFTPQQISAYILQNLKKTAEDYLGATVTEAVITVPAYFNDAQRQATKDAGTIAG LNVRRIINEPTASALAYGIDKTDKEQTILVFDLGGGTFDVSILHLADGTFEVVSTSGDNKLGGDDFDHKI YEFLAAEFNKEHGIDLLKDKMALQRLRDAAEKAKKELSGVTTSSISLPFITMGAAGPLHFEYNLTRAKFN ELTKDLVDRTMVSVRRALADAKLTNSDINQILLVGGSTRIPAVQELVTKEFGKEPNRSVNPDEVVAMGAA IQGAVLAGDVKDVLLLDVTPLSLGIETLGGVATRLIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERP MAADNKTLGRFQLTDIPPARRGVPQIEVTFDIDANGIVSVKAKDLGTNKEQKITISGNGGLSKEEIDAMI KQAEENAEADNKRKESADARNEADSMIFQSRKAIEDLGAEVTDEEKETVENAIKDLEEALKGDDVEAIKA KNEALAKASQSIAMKAYEKANKSNGSDVNGATDADDNKDDAVEAEFTEKQ

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCGAAGACAAATAAAATTATTGGAATTGACTTAGGAACTACAAACTCAGTTGTATCAGTGATGGAAGGTAACGAAGCAAAAGTTAT
CCCAAATGCTGAAGGTGGACGTACAACACCAAGTATCGTTGCTTTTAAAGGTGACGAAATATTAGTGGGTGAAGTTGCGAAACGCCAACT
TATTACAAACCCAGATACAATTTATAGTATCAAACGTCACATGGGTGATTTAAACTATAAAGTAAAAGCAGCTGGTAAAGAATTTACACC
TCAACAAATTTCTGCTTATATCTTACAAAACTTAAAGAAAACAGCAGAAGATTACCTAGGTGCAACAGTTACTGAAGCAGTTATTACTGT
ACCTGCATATTTTAATGACGCTCAACGTCAAGCTACAAAAGACGCTGGTACAATCGCAGGATTAAACGTTAGACGTATTATTAACGAACC
AACAGCATCAGCACTAGCTTATGGTATTGATAAAACAGACAAAGAACAAACTATCTTAGTATTTGACTTAGGTGGTGGTACATTTGACGT
GTCTATCTTACACTTAGCTGATGGTACATTTGAAGTTGTATCAACATCAGGTGATAACAAACTTGGTGGGGACGACTTTGACCACAAAAT
TTATGAATTCTTAGCAGCTGAATTTAATAAAGAACACGGTATTGATTTACTAAAAGATAAAATGGCTTTACAACGTCTACGTGATGCAGC
AGAAAAAGCTAAGAAAGAATTATCAGGTGTAACAACAAGTTCTATTTCTCTACCATTTATTACAATGGGAGCAGCAGGTCCGTTACACTT
TGAATATAACTTAACGCGTGCTAAATTTAATGAATTGACTAAAGATTTAGTAGATCGTACAATGGTATCTGTTAGACGTGCTTTAGCTGA
TGCTAAATTAACAAACTCTGATATTAATCAAATCTTATTAGTTGGTGGTTCAACAAGAATTCCAGCTGTTCAAGAACTTGTAACAAAAGA
ATTTGGTAAAGAACCTAATAGATCGGTAAACCCTGATGAAGTTGTAGCAATGGGTGCTGCAATCCAAGGTGCTGTTTTAGCAGGGGATGT
TAAAGACGTATTATTACTTGACGTTACACCATTATCATTAGGTATTGAAACACTTGGTGGTGTCGCAACAAGATTAATCGAAAGAAATAC
AACAATTCCTACATCTAAATCACAAGTATTCTCAACTGCAGCAGATAACCAACCAGCTGTAGACATTCACGTATTACAAGGTGAAAGACC
AATGGCAGCTGACAATAAAACACTTGGACGCTTCCAATTAACAGATATTCCACCAGCAAGACGTGGTGTACCTCAAATTGAAGTTACATT
TGATATTGACGCAAACGGTATTGTTTCTGTTAAAGCTAAAGACTTAGGTACAAATAAAGAACAAAAGATTACAATCTCTGGTAACGGTGG
ATTATCTAAAGAAGAAATTGATGCAATGATCAAACAAGCTGAAGAAAACGCAGAAGCAGATAACAAACGTAAAGAATCTGCAGATGCTAG
AAACGAAGCTGATAGCATGATTTTCCAATCTAGAAAAGCAATCGAAGACTTAGGTGCTGAAGTTACAGATGAAGAAAAAGAAACCGTAGA
AAACGCAATTAAAGACTTAGAAGAAGCATTAAAAGGTGATGACGTAGAAGCTATTAAAGCTAAAAATGAAGCACTTGCTAAAGCGAGCCA
ATCTATTGCTATGAAAGCATACGAAAAAGCTAACAAATCAAACGGATCAGATGTAAACGGAGCAACTGATGCAGATGATAATAAAGATGA
TGCTGTAGAAGCTGAATTTACTGAAAAACAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine70139 %
Guanine35520 %
Thyamine47727 %
Cytosine30017 %
A+T117865 %
G+C65536 %

Total Bases :   1833 bases

Microsatellites
SequencePosition LengthRepeats
GGTGGTGGT51933

Microsatellite Map

ATGGCGAAGACAAATAAAATTATTGGAATTGACTTAGGAACTACAAACTCAGTTGTATCAGTGATGGAAGGTAACGAAGCAAAAGTTATC
CCAAATGCTGAAGGTGGACGTACAACACCAAGTATCGTTGCTTTTAAAGGTGACGAAATATTAGTGGGTGAAGTTGCGAAACGCCAACTT
ATTACAAACCCAGATACAATTTATAGTATCAAACGTCACATGGGTGATTTAAACTATAAAGTAAAAGCAGCTGGTAAAGAATTTACACCT
CAACAAATTTCTGCTTATATCTTACAAAACTTAAAGAAAACAGCAGAAGATTACCTAGGTGCAACAGTTACTGAAGCAGTTATTACTGTA
CCTGCATATTTTAATGACGCTCAACGTCAAGCTACAAAAGACGCTGGTACAATCGCAGGATTAAACGTTAGACGTATTATTAACGAACCA
ACAGCATCAGCACTAGCTTATGGTATTGATAAAACAGACAAAGAACAAACTATCTTAGTATTTGACTTAGGTGGTGGTACATTTGACGTG
TCTATCTTACACTTAGCTGATGGTACATTTGAAGTTGTATCAACATCAGGTGATAACAAACTTGGTGGGGACGACTTTGACCACAAAATT
TATGAATTCTTAGCAGCTGAATTTAATAAAGAACACGGTATTGATTTACTAAAAGATAAAATGGCTTTACAACGTCTACGTGATGCAGCA
GAAAAAGCTAAGAAAGAATTATCAGGTGTAACAACAAGTTCTATTTCTCTACCATTTATTACAATGGGAGCAGCAGGTCCGTTACACTTT
GAATATAACTTAACGCGTGCTAAATTTAATGAATTGACTAAAGATTTAGTAGATCGTACAATGGTATCTGTTAGACGTGCTTTAGCTGAT
GCTAAATTAACAAACTCTGATATTAATCAAATCTTATTAGTTGGTGGTTCAACAAGAATTCCAGCTGTTCAAGAACTTGTAACAAAAGAA
TTTGGTAAAGAACCTAATAGATCGGTAAACCCTGATGAAGTTGTAGCAATGGGTGCTGCAATCCAAGGTGCTGTTTTAGCAGGGGATGTT
AAAGACGTATTATTACTTGACGTTACACCATTATCATTAGGTATTGAAACACTTGGTGGTGTCGCAACAAGATTAATCGAAAGAAATACA
ACAATTCCTACATCTAAATCACAAGTATTCTCAACTGCAGCAGATAACCAACCAGCTGTAGACATTCACGTATTACAAGGTGAAAGACCA
ATGGCAGCTGACAATAAAACACTTGGACGCTTCCAATTAACAGATATTCCACCAGCAAGACGTGGTGTACCTCAAATTGAAGTTACATTT
GATATTGACGCAAACGGTATTGTTTCTGTTAAAGCTAAAGACTTAGGTACAAATAAAGAACAAAAGATTACAATCTCTGGTAACGGTGGA
TTATCTAAAGAAGAAATTGATGCAATGATCAAACAAGCTGAAGAAAACGCAGAAGCAGATAACAAACGTAAAGAATCTGCAGATGCTAGA
AACGAAGCTGATAGCATGATTTTCCAATCTAGAAAAGCAATCGAAGACTTAGGTGCTGAAGTTACAGATGAAGAAAAAGAAACCGTAGAA
AACGCAATTAAAGACTTAGAAGAAGCATTAAAAGGTGATGACGTAGAAGCTATTAAAGCTAAAAATGAAGCACTTGCTAAAGCGAGCCAA
TCTATTGCTATGAAAGCATACGAAAAAGCTAACAAATCAAACGGATCAGATGTAAACGGAGCAACTGATGCAGATGATAATAAAGATGAT
GCTGTAGAAGCTGAATTTACTGAAAAACAATAA

Gene Information
Molecule Type genomic DNA
Bases 1833 Bases
Molecular Weight568225.2 Da
Coding Sequence CP000896.1:585650..587482
NCBI ReferenceABX81168
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 7 to 361 355 N-terminal nucleotide/ATP binding domain PF00012
Linker 362 to 368 7 Linker region Manually identified
Substrate Binding Domain 369 to 598 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 226 to 253 28 Coiled coil region Manually identified
Coiled Coil 482 to 512 31 Coiled coil region Manually identified
Coiled Coil 529 to 563 35 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACLA1

Accession Number

HSP70_0005

Added on

2012-02-02

Updated On

2014-01-20