Help  Custom Search
 
DnaK family protein of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaK family protein

Synonymous Names

B0BYQ6_ACAM1, Hsp70, Heat shock 70 kDa protein, Heat shock protein 70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

AM1_2057

Gene Identifier

5680871

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MSYAIDFGTSNTVIARWNPVTEQSEIINLPSLSYQTAQNPDLIPSLLYVEQAAENKVCVGQQVRDRGLDI QNDPRFFRSFKRGIGSKVQGFLPELDGQTIQFEQVGRWFLQTILQQLQTTHPDVKESLVLTVPVDSFETY RHWLGQVCQDLQVEQVRMIDEPTAAALGYGKADQDVLLVVDFGGGTFDLSLVQINTSQQKTQPLGFILKW GDKNLADTSKQRPQSARVLAKAGQNLGGTDIDNWLVDHFAKTQNLAVTPLTTRLAERLKIQLSLQPKATE VYFNEETFDSYELALDREQFDQILKEHQFFDRLDDSMTQVLQQARRQGLEVDDIKAVLLVGGTSQIPAVQ TWVQQYFDDSRICSSRPFEAIAQGALQVAQGLEVKDFLYHSYGVRYWDRRQQAHSWHPIIPAGLPYPMEE PIELTLGASTDAQPSIELILGELGNTNSGTEVFFDGDRLVTRQLSESQTLVQPLNDRDGSRKVAKLTPPG YPGSDRIKVLFWVDNRRTLRISVEDLLTQDTLLKNQVVAQLS

FASTA Format Composition Secondary Structure

Nucleotide
 TTGAGTTACGCAATAGATTTTGGTACCAGTAATACCGTTATTGCTCGTTGGAACCCGGTTACAGAGCAATCTGAAATTATTAATCTGCC
CAGTTTGAGCTATCAGACGGCCCAAAATCCTGACCTTATCCCCAGTCTGCTCTATGTAGAGCAAGCGGCGGAGAATAAAGTCTGTGTGGG
GCAACAGGTGCGAGATCGCGGCTTGGATATCCAAAATGATCCGCGCTTTTTTCGCAGTTTTAAACGGGGAATTGGGTCCAAGGTCCAAGG
GTTTTTGCCGGAACTGGATGGCCAAACCATTCAGTTTGAACAGGTGGGACGCTGGTTTTTGCAAACGATTCTCCAGCAGCTCCAAACCAC
CCATCCGGACGTGAAAGAGTCCTTAGTTCTGACGGTTCCAGTCGATAGCTTTGAAACCTATCGCCATTGGCTGGGGCAGGTCTGCCAAGA
TCTGCAGGTGGAGCAGGTGCGGATGATCGATGAACCCACCGCCGCAGCCTTAGGCTATGGCAAAGCCGATCAAGATGTGCTGCTGGTGGT
GGATTTTGGAGGCGGTACCTTCGATCTGTCTCTGGTCCAGATCAATACGTCGCAACAAAAGACCCAGCCTTTGGGCTTCATTCTGAAGTG
GGGCGATAAGAATCTAGCGGATACCTCAAAACAACGACCGCAATCAGCCCGCGTCTTGGCGAAAGCGGGTCAGAACTTGGGGGGCACCGA
TATTGATAATTGGCTCGTCGATCACTTTGCCAAAACGCAAAACTTAGCCGTCACTCCCCTGACGACTCGCTTAGCCGAGCGGCTCAAAAT
TCAACTCTCCCTACAGCCCAAGGCGACCGAGGTTTACTTTAATGAGGAAACCTTTGATAGTTATGAGCTTGCTTTGGATCGAGAACAATT
TGATCAAATTCTCAAGGAGCATCAGTTCTTTGATCGTTTAGATGACAGCATGACCCAGGTCTTGCAACAGGCTCGTCGCCAAGGTTTAGA
GGTTGATGATATTAAAGCCGTTCTGCTGGTGGGGGGAACCAGTCAGATTCCTGCAGTTCAAACCTGGGTGCAGCAATATTTTGATGACAG
CCGCATTTGCAGTAGCCGCCCCTTTGAAGCGATTGCCCAAGGCGCTTTACAGGTAGCCCAGGGTTTAGAGGTGAAAGATTTTCTCTACCA
CAGCTACGGCGTTCGCTACTGGGACCGCCGTCAACAGGCCCATAGTTGGCATCCGATTATTCCTGCAGGCTTGCCCTATCCCATGGAGGA
ACCGATTGAACTGACCCTCGGGGCTTCAACGGATGCTCAGCCTAGCATTGAACTCATCTTGGGAGAGTTGGGTAATACCAATAGTGGCAC
TGAAGTCTTTTTCGATGGTGATCGCTTAGTAACTCGGCAATTATCTGAATCCCAAACCCTGGTTCAACCTTTGAATGATCGGGATGGGTC
ACGGAAAGTGGCGAAGTTAACACCGCCGGGGTATCCGGGCAGCGATCGCATCAAAGTACTGTTTTGGGTCGATAATCGACGCACCTTGCG
CATCAGCGTTGAAGATCTGTTAACTCAAGATACCCTGCTCAAAAACCAGGTGGTTGCCCAACTCAGCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine39725 %
Guanine41526 %
Thyamine39725 %
Cytosine39025 %
A+T79450 %
G+C80551 %

Total Bases :   1599 bases

Microsatellites
SequencePosition LengthRepeats
TGTGTG17123
TTTTTT22523
TGGTGGTGG53233
GGGGGG70723
GGGGGG101923

Microsatellite Map

TTGAGTTACGCAATAGATTTTGGTACCAGTAATACCGTTATTGCTCGTTGGAACCCGGTTACAGAGCAATCTGAAATTATTAATCTGCCC
AGTTTGAGCTATCAGACGGCCCAAAATCCTGACCTTATCCCCAGTCTGCTCTATGTAGAGCAAGCGGCGGAGAATAAAGTCTGTGTGGGG
CAACAGGTGCGAGATCGCGGCTTGGATATCCAAAATGATCCGCGCTTTTTTCGCAGTTTTAAACGGGGAATTGGGTCCAAGGTCCAAGGG
TTTTTGCCGGAACTGGATGGCCAAACCATTCAGTTTGAACAGGTGGGACGCTGGTTTTTGCAAACGATTCTCCAGCAGCTCCAAACCACC
CATCCGGACGTGAAAGAGTCCTTAGTTCTGACGGTTCCAGTCGATAGCTTTGAAACCTATCGCCATTGGCTGGGGCAGGTCTGCCAAGAT
CTGCAGGTGGAGCAGGTGCGGATGATCGATGAACCCACCGCCGCAGCCTTAGGCTATGGCAAAGCCGATCAAGATGTGCTGCTGGTGGTG
GATTTTGGAGGCGGTACCTTCGATCTGTCTCTGGTCCAGATCAATACGTCGCAACAAAAGACCCAGCCTTTGGGCTTCATTCTGAAGTGG
GGCGATAAGAATCTAGCGGATACCTCAAAACAACGACCGCAATCAGCCCGCGTCTTGGCGAAAGCGGGTCAGAACTTGGGGGGCACCGAT
ATTGATAATTGGCTCGTCGATCACTTTGCCAAAACGCAAAACTTAGCCGTCACTCCCCTGACGACTCGCTTAGCCGAGCGGCTCAAAATT
CAACTCTCCCTACAGCCCAAGGCGACCGAGGTTTACTTTAATGAGGAAACCTTTGATAGTTATGAGCTTGCTTTGGATCGAGAACAATTT
GATCAAATTCTCAAGGAGCATCAGTTCTTTGATCGTTTAGATGACAGCATGACCCAGGTCTTGCAACAGGCTCGTCGCCAAGGTTTAGAG
GTTGATGATATTAAAGCCGTTCTGCTGGTGGGGGGAACCAGTCAGATTCCTGCAGTTCAAACCTGGGTGCAGCAATATTTTGATGACAGC
CGCATTTGCAGTAGCCGCCCCTTTGAAGCGATTGCCCAAGGCGCTTTACAGGTAGCCCAGGGTTTAGAGGTGAAAGATTTTCTCTACCAC
AGCTACGGCGTTCGCTACTGGGACCGCCGTCAACAGGCCCATAGTTGGCATCCGATTATTCCTGCAGGCTTGCCCTATCCCATGGAGGAA
CCGATTGAACTGACCCTCGGGGCTTCAACGGATGCTCAGCCTAGCATTGAACTCATCTTGGGAGAGTTGGGTAATACCAATAGTGGCACT
GAAGTCTTTTTCGATGGTGATCGCTTAGTAACTCGGCAATTATCTGAATCCCAAACCCTGGTTCAACCTTTGAATGATCGGGATGGGTCA
CGGAAAGTGGCGAAGTTAACACCGCCGGGGTATCCGGGCAGCGATCGCATCAAAGTACTGTTTTGGGTCGATAATCGACGCACCTTGCGC
ATCAGCGTTGAAGATCTGTTAACTCAAGATACCCTGCTCAAAAACCAGGTGGTTGCCCAACTCAGCTAA

Gene Information
Molecule Type genomic DNA
Bases 1599 Bases
Molecular Weight494452.16 Da
Coding Sequence complement(CP000828.1:2051207..2052805)
NCBI ReferenceABW27072
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 92 to 202 111 N-terminal nucleotide/ATP binding domain PF00012
Substrate Binding Domain 226 to 395 170 C-terminal substrate/peptide binding domain PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACMA4

Accession Number

HSP70_0004

Added on

2012-02-02

Updated On

2014-01-20