Help  Custom Search
 
molecular chaperone DnaK of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone DnaK

Synonymous Names

B0C457_ACAM1, Hsp70, Heat shock 70 kDa protein, Heat shock protein 70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

AM1_2440

Gene Identifier

5681252

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MAKVVGIDLGTTNSCVAVMEGGKPTVIANAEGFRTTPSVVAYAKNGDRLVGQIAKRQSVMNPENTFYSVK RFIGRRQDEVTHETTEVSYQVLTEGGSIKVDCPAAGKKFAPEEISAQVLRKLVDDASKYLGEKVTQAVIT VPAYFNDSQRQATKDAGKIAGVEVLRIINEPTAASLAYGLDKKSNETILVFDLGGGTFDVSVLEVGDGVF EVLSTSGDTHLGGDDFDKQIVDYLAAEFQKAEGIDLRKDKQALQRLTEAAEKAKIELSNVTQADVNLPFI TATQDGPKHLDTTLTRAKFEELCSDLIDRCRIPVENAVRDAKIDKSALDEVVMVGGSTRIPAILEVVKKV LGKEPNQSVNPDEVVAVGAAIQGGVLAGEVKDILLLDVTPLSLGVETLGGVMTKLIPRNTTIPTKKSEVF STAVDGQTNVEIHVLQGEREMSTDNKSLGTFRLDGIPPAPRGVPQIEVTFDIDANGILNVTAKEKGTGKE QSISITGASTLSDAEVDKMVQDAEQNASVDKERREKIETKNQADTLVYQSEKQLSELGDKVSGEDKEKAE GLIKDLKEAIASENHEQMQSLTTELQQTLYSISTQLYQQGDAAAAGAPEGATPDEPSDTAGGDDDVIDAD FTETN

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAAAAGTTGTTGGAATAGATTTAGGAACCACTAACTCTTGCGTAGCAGTGATGGAAGGGGGCAAACCCACGGTCATTGCCAATGC
AGAAGGATTCCGGACAACCCCCTCCGTTGTCGCTTATGCCAAAAATGGTGATCGCTTGGTCGGTCAAATTGCCAAGCGCCAATCGGTCAT
GAACCCTGAGAATACGTTCTACTCAGTGAAGCGATTCATTGGCCGCCGTCAAGACGAAGTCACCCATGAAACGACTGAAGTCTCCTATCA
AGTCCTCACTGAAGGGGGCAGCATTAAAGTGGACTGCCCTGCAGCAGGCAAAAAGTTTGCCCCTGAAGAGATTTCAGCTCAGGTACTCCG
CAAATTAGTCGATGATGCCAGTAAATATCTCGGCGAAAAAGTCACTCAGGCGGTAATTACCGTTCCCGCCTATTTCAACGATTCCCAACG
CCAAGCCACAAAGGATGCCGGCAAGATTGCCGGTGTGGAAGTCCTGCGGATTATCAACGAGCCCACCGCTGCTTCGCTCGCCTACGGTTT
AGATAAAAAAAGCAACGAAACCATTTTGGTATTTGACTTGGGGGGAGGAACCTTCGACGTCTCCGTACTTGAAGTGGGTGACGGTGTGTT
TGAAGTACTCTCCACTTCGGGTGATACCCACTTGGGCGGGGATGACTTCGACAAGCAGATTGTGGATTACTTGGCAGCCGAGTTCCAGAA
AGCCGAAGGGATTGATCTACGCAAAGACAAGCAAGCCCTACAGCGTCTGACTGAAGCAGCAGAAAAAGCCAAAATTGAGCTTTCCAATGT
CACCCAAGCGGATGTCAACCTTCCCTTTATCACAGCGACTCAAGATGGTCCTAAGCATTTAGACACCACCCTTACTCGCGCTAAGTTTGA
AGAGCTCTGTTCTGATTTGATCGATCGCTGTCGGATTCCCGTTGAGAATGCCGTCCGTGACGCCAAAATCGATAAGAGCGCTCTTGATGA
AGTGGTGATGGTTGGGGGTTCCACCCGCATTCCCGCGATTTTAGAAGTCGTTAAGAAAGTCCTCGGTAAAGAACCCAACCAATCCGTTAA
CCCTGATGAAGTGGTTGCCGTCGGTGCTGCCATTCAAGGGGGTGTGCTGGCCGGTGAAGTTAAAGATATTCTCTTACTAGACGTCACACC
GCTATCCTTGGGAGTTGAAACCCTTGGTGGTGTGATGACCAAGCTGATTCCCAGAAACACCACGATTCCCACCAAGAAATCAGAAGTGTT
CTCAACGGCGGTGGATGGCCAAACCAATGTGGAGATTCATGTACTCCAGGGTGAGCGGGAAATGTCTACAGACAACAAGAGTCTGGGAAC
CTTCCGCTTAGACGGCATTCCTCCCGCACCGCGAGGCGTGCCTCAAATTGAAGTCACCTTTGATATTGATGCCAACGGTATTCTCAATGT
CACTGCTAAAGAAAAAGGCACTGGCAAAGAACAATCCATTAGCATTACGGGGGCTTCCACCCTGTCCGATGCTGAAGTCGACAAGATGGT
TCAAGATGCAGAGCAAAATGCCTCTGTAGACAAAGAACGTCGCGAGAAGATCGAGACCAAGAACCAGGCCGATACGCTGGTGTACCAATC
CGAGAAGCAGTTGTCTGAATTAGGCGATAAGGTTTCCGGTGAGGATAAAGAGAAGGCTGAAGGTCTGATCAAAGATCTGAAAGAAGCTAT
CGCCAGTGAAAACCATGAGCAAATGCAGTCTCTAACCACTGAGTTGCAGCAAACCCTATACAGCATCAGCACACAGCTATATCAGCAAGG
TGATGCCGCTGCTGCAGGGGCACCCGAAGGGGCTACTCCAGATGAGCCCAGTGATACCGCTGGTGGCGACGATGATGTCATCGATGCTGA
TTTCACTGAAACGAACTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine53228 %
Guanine48826 %
Thyamine42123 %
Cytosine46725 %
A+T95350 %
G+C95551 %

Total Bases :   1908 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA54323
GGGGGG57823
GTGTGT62223
CACACA177823

Microsatellite Map

ATGGCAAAAGTTGTTGGAATAGATTTAGGAACCACTAACTCTTGCGTAGCAGTGATGGAAGGGGGCAAACCCACGGTCATTGCCAATGCA
GAAGGATTCCGGACAACCCCCTCCGTTGTCGCTTATGCCAAAAATGGTGATCGCTTGGTCGGTCAAATTGCCAAGCGCCAATCGGTCATG
AACCCTGAGAATACGTTCTACTCAGTGAAGCGATTCATTGGCCGCCGTCAAGACGAAGTCACCCATGAAACGACTGAAGTCTCCTATCAA
GTCCTCACTGAAGGGGGCAGCATTAAAGTGGACTGCCCTGCAGCAGGCAAAAAGTTTGCCCCTGAAGAGATTTCAGCTCAGGTACTCCGC
AAATTAGTCGATGATGCCAGTAAATATCTCGGCGAAAAAGTCACTCAGGCGGTAATTACCGTTCCCGCCTATTTCAACGATTCCCAACGC
CAAGCCACAAAGGATGCCGGCAAGATTGCCGGTGTGGAAGTCCTGCGGATTATCAACGAGCCCACCGCTGCTTCGCTCGCCTACGGTTTA
GATAAAAAAAGCAACGAAACCATTTTGGTATTTGACTTGGGGGGAGGAACCTTCGACGTCTCCGTACTTGAAGTGGGTGACGGTGTGTTT
GAAGTACTCTCCACTTCGGGTGATACCCACTTGGGCGGGGATGACTTCGACAAGCAGATTGTGGATTACTTGGCAGCCGAGTTCCAGAAA
GCCGAAGGGATTGATCTACGCAAAGACAAGCAAGCCCTACAGCGTCTGACTGAAGCAGCAGAAAAAGCCAAAATTGAGCTTTCCAATGTC
ACCCAAGCGGATGTCAACCTTCCCTTTATCACAGCGACTCAAGATGGTCCTAAGCATTTAGACACCACCCTTACTCGCGCTAAGTTTGAA
GAGCTCTGTTCTGATTTGATCGATCGCTGTCGGATTCCCGTTGAGAATGCCGTCCGTGACGCCAAAATCGATAAGAGCGCTCTTGATGAA
GTGGTGATGGTTGGGGGTTCCACCCGCATTCCCGCGATTTTAGAAGTCGTTAAGAAAGTCCTCGGTAAAGAACCCAACCAATCCGTTAAC
CCTGATGAAGTGGTTGCCGTCGGTGCTGCCATTCAAGGGGGTGTGCTGGCCGGTGAAGTTAAAGATATTCTCTTACTAGACGTCACACCG
CTATCCTTGGGAGTTGAAACCCTTGGTGGTGTGATGACCAAGCTGATTCCCAGAAACACCACGATTCCCACCAAGAAATCAGAAGTGTTC
TCAACGGCGGTGGATGGCCAAACCAATGTGGAGATTCATGTACTCCAGGGTGAGCGGGAAATGTCTACAGACAACAAGAGTCTGGGAACC
TTCCGCTTAGACGGCATTCCTCCCGCACCGCGAGGCGTGCCTCAAATTGAAGTCACCTTTGATATTGATGCCAACGGTATTCTCAATGTC
ACTGCTAAAGAAAAAGGCACTGGCAAAGAACAATCCATTAGCATTACGGGGGCTTCCACCCTGTCCGATGCTGAAGTCGACAAGATGGTT
CAAGATGCAGAGCAAAATGCCTCTGTAGACAAAGAACGTCGCGAGAAGATCGAGACCAAGAACCAGGCCGATACGCTGGTGTACCAATCC
GAGAAGCAGTTGTCTGAATTAGGCGATAAGGTTTCCGGTGAGGATAAAGAGAAGGCTGAAGGTCTGATCAAAGATCTGAAAGAAGCTATC
GCCAGTGAAAACCATGAGCAAATGCAGTCTCTAACCACTGAGTTGCAGCAAACCCTATACAGCATCAGCACACAGCTATATCAGCAAGGT
GATGCCGCTGCTGCAGGGGCACCCGAAGGGGCTACTCCAGATGAGCCCAGTGATACCGCTGGTGGCGACGATGATGTCATCGATGCTGAT
TTCACTGAAACGAACTAG

Gene Information
Molecule Type genomic DNA
Bases 1908 Bases
Molecular Weight590335.5 Da
Coding Sequence CP000828.1:2445301..2447208
NCBI ReferenceABW27448
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 381 378 N-terminal nucleotide/ATP binding domain PF00012
Linker 382 to 388 7 Linker region Manually identified
Substrate Binding Domain 389 to 598 210 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 246 to 273 28 Coiled coil region Manually identified
Coiled Coil 510 to 530 21 Coiled coil region Manually identified
Coiled Coil 556 to 576 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACMA2

Accession Number

HSP70_0002

Added on

2012-02-02

Updated On

2014-01-20