Help  Custom Search
 
molecular chaperone DnaK of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone DnaK

Synonymous Names

B0CG86_ACAM1, Hsp70, Heat shock 70 kDa protein, Heat shock protein 70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

AM1_5692

Gene Identifier

5684480

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MGRIVGIDLGTTNSVVAVMEGGKPVVIANTEGSRTTPSVVAFGKEGERLIGQLARRQTVLNPQNTFYAFK RFLGRRYSELSAFSKRVPYTIRRDQADNVKIKCPALEREFAPEEVSAMILRKLADEASRFLGEPITGAVI TVPAYFNDAQRQATRDAGRIAGLEVKRIINEPTAAALAYGLDNQYNQTVMVVDLGGGTFDVSILDVGDSV FEVRATAGDTQLGGTDFDRVIVDWLAEQFLEKENIDLRREPQSLQRLTEAAEKAKVELSGLPETNVSLPF ITATEEGPKHMDVVLSRGQFENLCADLAERLQAPVERALRDSNLRSIDIDEVVLVGGSTRIPMVQTLIGQ MINKRPNQNVNPDEVVAVGAAIQAGITAGDLQDIFLLDVTPLSFGLETIGGVMKTLIPRNTTIPVRRSDV FSTAQDNQNQVEVHVLQGERQLANNNKSLGRFQLRGIPPAPRGVPQVQVSFDIDANGILQVTAMDKYTGR EQTITVQGAANLSDSEVNRMLQEAEQFADKDRLRRERIDKRNRGQDLISQCDRKLREITLDFGPQFASNL RRRVETLSRDLQDSINQDQDRQIDLDYANLQDALYELNQEVARVNQEYYDDEEELFPLPSMSSISEAVSK GVNKGVELVTGRPSSDDPPPRRSSSRMDGDFWEDWDDDDW

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGGCAGAATTGTCGGCATTGACCTAGGTACTACTAATTCAGTGGTGGCAGTGATGGAAGGGGGCAAGCCAGTGGTGATTGCCAATAC
CGAAGGTAGCCGTACAACTCCTTCTGTGGTGGCGTTTGGCAAAGAAGGTGAACGGCTGATAGGTCAGCTGGCCCGCAGACAAACCGTCCT
CAATCCCCAGAATACCTTCTATGCCTTTAAGCGATTCCTGGGGCGTCGGTATAGTGAACTATCGGCTTTTTCCAAACGGGTGCCCTATAC
AATTCGGCGCGACCAGGCGGACAATGTCAAAATTAAATGCCCAGCTTTGGAGCGAGAATTCGCCCCGGAAGAAGTATCGGCCATGATTCT
GCGGAAACTGGCGGATGAGGCGAGCCGTTTTCTGGGAGAACCCATTACTGGGGCAGTGATTACGGTGCCTGCCTACTTTAATGATGCTCA
GCGACAGGCCACGCGGGATGCGGGGCGAATTGCGGGGTTAGAGGTCAAGCGGATTATCAATGAGCCGACGGCGGCAGCCCTGGCCTATGG
ACTGGACAATCAGTACAACCAGACGGTGATGGTGGTTGATTTAGGCGGCGGGACCTTTGATGTCTCGATCCTAGATGTGGGAGATTCGGT
CTTTGAAGTGCGAGCGACGGCTGGAGACACGCAATTAGGCGGCACGGACTTTGACCGGGTGATCGTCGATTGGCTGGCGGAACAGTTTCT
AGAGAAAGAAAATATTGATTTGCGCCGGGAACCCCAGTCTTTACAGCGCCTGACGGAAGCGGCGGAAAAGGCCAAAGTTGAACTATCGGG
CTTGCCGGAGACCAATGTGAGCCTGCCCTTTATCACGGCGACAGAAGAAGGCCCCAAACATATGGATGTGGTGTTGAGCCGGGGGCAGTT
TGAGAATTTATGTGCCGATCTAGCAGAGCGACTACAGGCTCCGGTGGAGAGGGCTTTGCGGGATAGTAATCTTCGCTCCATCGATATTGA
TGAAGTGGTGTTAGTGGGCGGCTCCACCCGCATCCCCATGGTCCAGACCTTGATCGGTCAGATGATCAATAAGCGTCCCAATCAGAATGT
TAACCCGGATGAAGTGGTGGCTGTGGGAGCAGCGATCCAGGCTGGGATTACGGCAGGGGATTTGCAAGATATTTTCTTGTTGGATGTGAC
CCCCCTGTCCTTTGGCCTAGAAACCATTGGTGGGGTGATGAAGACCCTAATTCCCCGCAATACGACGATTCCCGTGCGGCGGTCTGATGT
CTTTTCAACGGCCCAGGACAATCAAAACCAGGTGGAAGTCCATGTGCTCCAAGGAGAGCGACAGCTAGCCAATAATAATAAATCCTTGGG
ACGATTTCAGCTGCGGGGTATTCCCCCCGCCCCCCGAGGGGTGCCCCAGGTCCAGGTGTCTTTTGATATCGATGCCAATGGCATTCTGCA
AGTGACGGCGATGGATAAATATACGGGCCGAGAACAAACCATTACGGTCCAAGGGGCGGCCAATCTGTCGGATTCTGAAGTCAACCGCAT
GCTCCAAGAAGCGGAGCAGTTTGCTGATAAGGATCGCCTGCGTCGGGAGCGCATTGATAAGCGGAACCGGGGGCAAGATCTGATTAGCCA
ATGCGATCGCAAGTTAAGAGAAATCACCCTAGATTTTGGTCCCCAGTTTGCCAGCAACCTCAGAAGGCGGGTCGAAACCCTCTCCCGAGA
TTTGCAAGACAGCATTAACCAGGATCAGGATCGTCAAATTGATTTGGACTATGCCAATCTCCAGGACGCCCTATACGAACTTAATCAAGA
GGTGGCTCGCGTCAATCAAGAGTACTACGATGATGAAGAAGAGCTGTTCCCCTTGCCTTCCATGTCTTCCATTAGTGAGGCGGTCTCTAA
AGGGGTGAATAAAGGCGTGGAATTGGTGACCGGGCGACCATCCTCAGATGATCCGCCCCCTCGTCGATCTTCGAGTCGAATGGATGGTGA
CTTCTGGGAAGACTGGGATGATGATGATTGGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine49125 %
Guanine59930 %
Thyamine45123 %
Cytosine47224 %
A+T94247 %
G+C107154 %

Total Bases :   2013 bases

Microsatellites
SequencePosition LengthRepeats
CCCCCC116823
AATAATAAT132933
CCCCCC137123
CCCCCC137823
GATGATGATGAT199534

Microsatellite Map

ATGGGCAGAATTGTCGGCATTGACCTAGGTACTACTAATTCAGTGGTGGCAGTGATGGAAGGGGGCAAGCCAGTGGTGATTGCCAATACC
GAAGGTAGCCGTACAACTCCTTCTGTGGTGGCGTTTGGCAAAGAAGGTGAACGGCTGATAGGTCAGCTGGCCCGCAGACAAACCGTCCTC
AATCCCCAGAATACCTTCTATGCCTTTAAGCGATTCCTGGGGCGTCGGTATAGTGAACTATCGGCTTTTTCCAAACGGGTGCCCTATACA
ATTCGGCGCGACCAGGCGGACAATGTCAAAATTAAATGCCCAGCTTTGGAGCGAGAATTCGCCCCGGAAGAAGTATCGGCCATGATTCTG
CGGAAACTGGCGGATGAGGCGAGCCGTTTTCTGGGAGAACCCATTACTGGGGCAGTGATTACGGTGCCTGCCTACTTTAATGATGCTCAG
CGACAGGCCACGCGGGATGCGGGGCGAATTGCGGGGTTAGAGGTCAAGCGGATTATCAATGAGCCGACGGCGGCAGCCCTGGCCTATGGA
CTGGACAATCAGTACAACCAGACGGTGATGGTGGTTGATTTAGGCGGCGGGACCTTTGATGTCTCGATCCTAGATGTGGGAGATTCGGTC
TTTGAAGTGCGAGCGACGGCTGGAGACACGCAATTAGGCGGCACGGACTTTGACCGGGTGATCGTCGATTGGCTGGCGGAACAGTTTCTA
GAGAAAGAAAATATTGATTTGCGCCGGGAACCCCAGTCTTTACAGCGCCTGACGGAAGCGGCGGAAAAGGCCAAAGTTGAACTATCGGGC
TTGCCGGAGACCAATGTGAGCCTGCCCTTTATCACGGCGACAGAAGAAGGCCCCAAACATATGGATGTGGTGTTGAGCCGGGGGCAGTTT
GAGAATTTATGTGCCGATCTAGCAGAGCGACTACAGGCTCCGGTGGAGAGGGCTTTGCGGGATAGTAATCTTCGCTCCATCGATATTGAT
GAAGTGGTGTTAGTGGGCGGCTCCACCCGCATCCCCATGGTCCAGACCTTGATCGGTCAGATGATCAATAAGCGTCCCAATCAGAATGTT
AACCCGGATGAAGTGGTGGCTGTGGGAGCAGCGATCCAGGCTGGGATTACGGCAGGGGATTTGCAAGATATTTTCTTGTTGGATGTGACC
CCCCTGTCCTTTGGCCTAGAAACCATTGGTGGGGTGATGAAGACCCTAATTCCCCGCAATACGACGATTCCCGTGCGGCGGTCTGATGTC
TTTTCAACGGCCCAGGACAATCAAAACCAGGTGGAAGTCCATGTGCTCCAAGGAGAGCGACAGCTAGCCAATAATAATAAATCCTTGGGA
CGATTTCAGCTGCGGGGTATTCCCCCCGCCCCCCGAGGGGTGCCCCAGGTCCAGGTGTCTTTTGATATCGATGCCAATGGCATTCTGCAA
GTGACGGCGATGGATAAATATACGGGCCGAGAACAAACCATTACGGTCCAAGGGGCGGCCAATCTGTCGGATTCTGAAGTCAACCGCATG
CTCCAAGAAGCGGAGCAGTTTGCTGATAAGGATCGCCTGCGTCGGGAGCGCATTGATAAGCGGAACCGGGGGCAAGATCTGATTAGCCAA
TGCGATCGCAAGTTAAGAGAAATCACCCTAGATTTTGGTCCCCAGTTTGCCAGCAACCTCAGAAGGCGGGTCGAAACCCTCTCCCGAGAT
TTGCAAGACAGCATTAACCAGGATCAGGATCGTCAAATTGATTTGGACTATGCCAATCTCCAGGACGCCCTATACGAACTTAATCAAGAG
GTGGCTCGCGTCAATCAAGAGTACTACGATGATGAAGAAGAGCTGTTCCCCTTGCCTTCCATGTCTTCCATTAGTGAGGCGGTCTCTAAA
GGGGTGAATAAAGGCGTGGAATTGGTGACCGGGCGACCATCCTCAGATGATCCGCCCCCTCGTCGATCTTCGAGTCGAATGGATGGTGAC
TTCTGGGAAGACTGGGATGATGATGATTGGTAA

Gene Information
Molecule Type genomic DNA
Bases 2013 Bases
Molecular Weight624608.1 Da
Coding Sequence CP000828.1:5760122..5762134
NCBI ReferenceABW30639
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 382 379 N-terminal nucleotide/ATP binding domain PF00012
Linker 383 to 389 7 Linker region Manually identified
Substrate Binding Domain 390 to 610 221 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 557 to 577 21 Coiled coil region Manually identified
Coiled Coil 587 to 607 31 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_ACMA1

Accession Number

HSP70_0001

Added on

2012-02-02

Updated On

2014-01-20