Help  Custom Search
 
chaperonin GroEL. of Thermus thermophilus str. HB27

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin GroEL.

Synonymous Names

CH60_THET2, Hsp60, Protein Cpn60 , groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

TTC1714

Gene Identifier

2776042

Taxon Information

Organism

Thermus thermophilus str. HB27

Organism ID

262724 [NCBI] [UNIPROT]

Lineage

Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae; Thermus; Thermus thermophilus HB27

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVELEDHLENIGA QLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIEKAVEAAVEKIKALAIPVEDR KAIEEVATISANDPEVGKLIADAMEKVGKEGIITVEESKSLETELKFVEGYQFDKGYISPYFVTNPETME AVLEDAFILIVEKKVSNVRELLPILEQVAQTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFG DRRKEMLKDIAAVTGGTVISEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKE LETTDSEYAREKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVTLLRA ISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVIVQQILAETKNPRYGFNAATGEFVDMV EAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPASAGAGDMDF

FASTA Format Composition Secondary Structure


			

Download Fasta Sequence


DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 3 to 518 516 GroEL/cpn60 chaperonin domain PF00118
Cd03344
Coiled coil 334 to 365 32 Coiled coil region Manually identified

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

1WE3 Jmol
1WF4 Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_THTH1

Accession Number

HSP60_0366

Added on

2012-02-02

Updated On

2012-06-20