Help  Custom Search
 
chaperonin GroEL. of Aeromonas hydrophila subsp. hydrophila str. ATCC7966

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin GroEL.

Synonymous Names

CH60_AERHH, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

AHA_0860

Gene Identifier

4487244

Taxon Information

Organism

Aeromonas hydrophila subsp. hydrophila str. ATCC7966

Organism ID

380703 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila subsp. hydrophila ATCC 7966

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAAKEVKFGNEARSKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFMNMG AQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVVAAVAELQALSQPCAD NNAIAQVGTISANSDEKVGKLIAEAMDKVGRDGVITVEDGQGLDDELAVVEGMQFDRGYLSPYFVNKPET GAVELDDPFILLVDKKVSNIREMLPVLEGVAKAGKPLIIVAEDVEGEALATLVVNTMRGIVKVAAVKAPG FGDRRKAMLQDIAILTGGTVISEEVGMELEKATLEDLGRAKRIVITKENTTIIDGVGDASLIESRVAQIR QQIEETSSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDALHATRAAVEEGVVAGGGVALV RVAAKLAGLRGDNEDQNVGIKVALRAMEAPLRQIVINAGEEASVIANAVKNGEGNFGYNAYTEQYGDMLA MGILDPTKVTRSALQFASSIAGLMITTECMISELPKKDAPAMPDMGGMGGMGMM

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAGCTAAAGAAGTCAAGTTTGGCAACGAAGCACGCAGCAAGATGCTGGAAGGCGTAAACATCCTGGCCGATGCCGTCAAGGTGAC
CCTGGGCCCGAAAGGCCGCAACGTGGTACTGGACAAGTCCTTCGGCGCGCCGACCATCACCAAGGACGGCGTCTCCGTTGCCCGTGAAAT
CGAGCTGGAAGACAAGTTCATGAACATGGGCGCCCAGATGGTCAAGGAAGTTGCTTCCAAGGCCAACGATGCCGCCGGTGACGGTACCAC
TACCGCTACCGTACTGGCTCAAGCCATCGTCAACGAAGGCCTGAAGGCCGTTGCCGCCGGCATGAACCCGATGGATCTGAAGCGCGGTAT
CGACAAGGCCGTAGTGGCCGCCGTTGCCGAGCTGCAAGCGCTGTCCCAGCCGTGTGCTGACAACAATGCCATCGCTCAGGTCGGCACCAT
CTCCGCCAACTCCGACGAGAAAGTGGGCAAGCTGATTGCCGAAGCCATGGACAAAGTCGGTCGTGACGGCGTCATCACCGTTGAAGACGG
TCAGGGTCTGGACGACGAGCTGGCCGTGGTAGAAGGCATGCAGTTCGATCGTGGCTACCTCTCCCCGTACTTCGTCAACAAGCCGGAAAC
CGGTGCCGTTGAGCTGGACGATCCCTTCATCCTGCTGGTCGACAAGAAAGTCTCCAACATCCGTGAAATGCTGCCGGTGCTGGAAGGCGT
AGCCAAAGCAGGCAAGCCGCTGATCATCGTGGCCGAAGACGTGGAAGGCGAAGCGCTGGCGACCCTGGTGGTCAACACCATGCGTGGCAT
CGTGAAAGTCGCGGCCGTCAAGGCACCTGGCTTCGGTGACCGTCGCAAAGCCATGCTGCAGGATATCGCCATCCTGACCGGTGGTACCGT
GATCTCCGAAGAAGTGGGCATGGAGCTGGAAAAAGCGACCTTGGAAGACCTGGGCCGTGCCAAGCGCATCGTCATCACCAAAGAGAACAC
CACCATCATCGATGGCGTGGGTGATGCATCTCTGATCGAGAGCCGTGTGGCCCAGATCCGTCAGCAGATCGAAGAGACCTCTTCCGATTA
CGACCGCGAGAAGCTGCAAGAGCGCGTAGCCAAACTGGCTGGCGGTGTTGCGGTGATCAAGGTTGGCGCTGCCACCGAAGTCGAGATGAA
AGAGAAGAAAGCCCGGGTTGACGACGCCCTGCACGCGACTCGCGCCGCTGTAGAAGAGGGTGTGGTTGCCGGTGGTGGTGTTGCGCTGGT
ACGCGTGGCCGCCAAACTGGCCGGCCTGCGTGGTGACAACGAAGATCAGAACGTGGGTATCAAGGTCGCTCTGCGCGCCATGGAAGCTCC
GCTGCGCCAGATCGTCATCAACGCCGGTGAAGAGGCCTCCGTCATCGCCAACGCGGTGAAGAACGGTGAAGGTAACTTCGGTTACAACGC
CTACACCGAACAGTACGGTGACATGCTGGCCATGGGTATCCTGGATCCGACCAAGGTGACCCGTTCTGCCCTGCAGTTCGCCTCTTCCAT
CGCCGGCCTGATGATCACCACCGAGTGCATGATCTCCGAGCTGCCGAAGAAAGATGCCCCTGCCATGCCTGACATGGGCGGCATGGGCGG
CATGGGCATGATGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine37123 %
Guanine51132 %
Thyamine28518 %
Cytosine46829 %
A+T65641 %
G+C97960 %

Total Bases :   1635 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC13323
GGTGGTGGT123933
GCGCGC133123

Microsatellite Map

ATGGCAGCTAAAGAAGTCAAGTTTGGCAACGAAGCACGCAGCAAGATGCTGGAAGGCGTAAACATCCTGGCCGATGCCGTCAAGGTGACC
CTGGGCCCGAAAGGCCGCAACGTGGTACTGGACAAGTCCTTCGGCGCGCCGACCATCACCAAGGACGGCGTCTCCGTTGCCCGTGAAATC
GAGCTGGAAGACAAGTTCATGAACATGGGCGCCCAGATGGTCAAGGAAGTTGCTTCCAAGGCCAACGATGCCGCCGGTGACGGTACCACT
ACCGCTACCGTACTGGCTCAAGCCATCGTCAACGAAGGCCTGAAGGCCGTTGCCGCCGGCATGAACCCGATGGATCTGAAGCGCGGTATC
GACAAGGCCGTAGTGGCCGCCGTTGCCGAGCTGCAAGCGCTGTCCCAGCCGTGTGCTGACAACAATGCCATCGCTCAGGTCGGCACCATC
TCCGCCAACTCCGACGAGAAAGTGGGCAAGCTGATTGCCGAAGCCATGGACAAAGTCGGTCGTGACGGCGTCATCACCGTTGAAGACGGT
CAGGGTCTGGACGACGAGCTGGCCGTGGTAGAAGGCATGCAGTTCGATCGTGGCTACCTCTCCCCGTACTTCGTCAACAAGCCGGAAACC
GGTGCCGTTGAGCTGGACGATCCCTTCATCCTGCTGGTCGACAAGAAAGTCTCCAACATCCGTGAAATGCTGCCGGTGCTGGAAGGCGTA
GCCAAAGCAGGCAAGCCGCTGATCATCGTGGCCGAAGACGTGGAAGGCGAAGCGCTGGCGACCCTGGTGGTCAACACCATGCGTGGCATC
GTGAAAGTCGCGGCCGTCAAGGCACCTGGCTTCGGTGACCGTCGCAAAGCCATGCTGCAGGATATCGCCATCCTGACCGGTGGTACCGTG
ATCTCCGAAGAAGTGGGCATGGAGCTGGAAAAAGCGACCTTGGAAGACCTGGGCCGTGCCAAGCGCATCGTCATCACCAAAGAGAACACC
ACCATCATCGATGGCGTGGGTGATGCATCTCTGATCGAGAGCCGTGTGGCCCAGATCCGTCAGCAGATCGAAGAGACCTCTTCCGATTAC
GACCGCGAGAAGCTGCAAGAGCGCGTAGCCAAACTGGCTGGCGGTGTTGCGGTGATCAAGGTTGGCGCTGCCACCGAAGTCGAGATGAAA
GAGAAGAAAGCCCGGGTTGACGACGCCCTGCACGCGACTCGCGCCGCTGTAGAAGAGGGTGTGGTTGCCGGTGGTGGTGTTGCGCTGGTA
CGCGTGGCCGCCAAACTGGCCGGCCTGCGTGGTGACAACGAAGATCAGAACGTGGGTATCAAGGTCGCTCTGCGCGCCATGGAAGCTCCG
CTGCGCCAGATCGTCATCAACGCCGGTGAAGAGGCCTCCGTCATCGCCAACGCGGTGAAGAACGGTGAAGGTAACTTCGGTTACAACGCC
TACACCGAACAGTACGGTGACATGCTGGCCATGGGTATCCTGGATCCGACCAAGGTGACCCGTTCTGCCCTGCAGTTCGCCTCTTCCATC
GCCGGCCTGATGATCACCACCGAGTGCATGATCTCCGAGCTGCCGAAGAAAGATGCCCCTGCCATGCCTGACATGGGCGGCATGGGCGGC
ATGGGCATGATGTAA

Gene Information
Molecule Type genomic DNA
Bases 1635 Bases
Molecular Weight506398.5 Da
Coding Sequence CP000462.1:924310..925944
NCBI ReferenceABK38064
Notesidentified by similarity to SP:P0A6F5; match to

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 4 to 523 520 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_AEHY1

Accession Number

HSP60_0025

Added on

2012-02-02

Updated On

2014-01-20