Help  Custom Search
 
co-chaperonin GroES. of Actinobacillus succinogenes str. 130Z

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

co-chaperonin GroES.

Synonymous Names

CH10_ACTSZ, Cpn10, 10 kDa protein, GroES protein.

Gene names

Gene Name

groES

Gene Locus Tag

Asuc_0663

Gene Identifier

5347913

Taxon Information

Organism

Actinobacillus succinogenes str. 130Z

Organism ID

339671 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus succinogenes 130Z

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAIRPLHDRVIIKREEVETLSAGGIVLTGSAATKSTRAKVLAVGKGRVLENGTVQPLDVKVGDTVIFNDG YGVKAEKIDGEEVLIISENDILAIVE

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAATTCGTCCTTTACACGATCGTGTAATTATTAAACGTGAAGAAGTAGAAACCCTTTCTGCCGGCGGTATCGTATTAACCGGTTC
CGCAGCGACAAAATCCACCCGAGCCAAAGTCTTGGCGGTAGGTAAAGGTCGCGTGCTGGAAAACGGCACAGTACAGCCTTTGGACGTTAA
AGTGGGCGACACCGTCATTTTCAACGACGGCTACGGCGTAAAAGCGGAAAAAATCGACGGCGAAGAAGTATTAATCATTTCTGAAAACGA
TATTTTAGCGATTGTCGAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine8931 %
Guanine7225 %
Thyamine6824 %
Cytosine6222 %
A+T15754 %
G+C13447 %

Total Bases :   291 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA22623

Microsatellite Map

ATGGCAATTCGTCCTTTACACGATCGTGTAATTATTAAACGTGAAGAAGTAGAAACCCTTTCTGCCGGCGGTATCGTATTAACCGGTTCC
GCAGCGACAAAATCCACCCGAGCCAAAGTCTTGGCGGTAGGTAAAGGTCGCGTGCTGGAAAACGGCACAGTACAGCCTTTGGACGTTAAA
GTGGGCGACACCGTCATTTTCAACGACGGCTACGGCGTAAAAGCGGAAAAAATCGACGGCGAAGAAGTATTAATCATTTCTGAAAACGAT
ATTTTAGCGATTGTCGAATAA

Gene Information
Molecule Type genomic DNA
Bases 291 Bases
Molecular Weight90131.61 Da
Coding Sequence complement(CP000746.1:723224..723514)
NCBI ReferenceABR74036
NotesPFAM: chaperonin Cpn10; KEGG: pmu:PM1106 10 KD

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 2 to 95 94 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACSU1

Accession Number

HSP60_0024

Added on

2012-02-02

Updated On

2014-01-20