Help  Custom Search
 
Chaperonin GroEL of Actinobacillus succinogenes str. 130Z

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL

Synonymous Names

CH60_ACTSZ, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

Asuc_0662

Gene Identifier

5347912

Taxon Information

Organism

Actinobacillus succinogenes str. 130Z

Organism ID

339671 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus succinogenes 130Z

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAAKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMG AQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVAAVVSELKALSKPCET SKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPET ATVEMDNPYILLVDKKISNIRELLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPG FGDRRKAMLQDIAILTAGTVISEEIGMELEKAALEDLGQAKRVVINKDNTTIIDGVGDEAQIKGRVAQIR QQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGIVAGGGVALI RAASKAAANLQGDNEEQNVGIKLALRAMEAPLRQIVANAGEEASVVASAVKNGEGNYGYNAGTEEYGDMI AMGILDPTKVTRSALQFAASIAGLMITTEAMVTELPKDDKLDPSAAMGGMGGMGGMM

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAGCAAAAGACGTTAAATTCGGTAATGATGCGCGCGTAAAAATGTTAGCGGGCGTAAACGTATTGGCAGATGCGGTAAAAGTGAC
CTTAGGTCCTAAAGGTCGTAACGTGATTTTAGACAAATCTTTCGGCGCACCGACCATCACCAAAGACGGCGTTTCCGTTGCGCGTGAAAT
CGAATTGGAAGATAAATTCGAAAACATGGGCGCACAAATGGTAAAAGAAGTGGCGTCTAAAGCAAATGATGCCGCGGGCGACGGTACCAC
CACCGCAACGGTTTTAGCGCAAGCTATTGTCAACGAAGGCTTAAAAGCCGTGGCGGCGGGTATGAACCCGATGGATTTAAAACGCGGTAT
CGACAAAGCGGTGGCGGCAGTGGTATCCGAATTGAAAGCCCTTTCCAAACCTTGCGAAACGTCGAAAGAAATCGAACAGGTGGGGACGAT
TTCCGCAAATAGTGACAGCATTGTCGGTCAATTAATCGCGCAAGCCATGGAAAAAGTAGGTAAAGAAGGCGTGATTACCGTTGAAGACGG
CACCGGTCTGGAAGACGAATTGGATGTCGTTGAAGGTATGCAATTCGATCGCGGTTATTTATCGCCGTACTTCATCAACAAACCGGAAAC
CGCAACGGTTGAAATGGATAATCCGTATATTTTATTGGTGGATAAAAAAATCTCCAATATCCGCGAATTATTACCGGTTTTAGAAGCCGT
GGCTAAAGCGGGCAAACCGTTATTAATCATCGCAGAAGATGTGGAAGGCGAAGCGTTGGCAACTTTAGTGGTTAACACCATGCGCGGTAT
CGTGAAAGTGGCGGCGGTGAAAGCGCCGGGCTTCGGCGATCGTCGTAAAGCTATGTTGCAAGACATCGCAATTCTTACCGCCGGTACCGT
CATTTCCGAAGAAATCGGTATGGAACTGGAAAAAGCCGCATTGGAAGATTTAGGTCAGGCTAAACGTGTCGTTATTAACAAAGACAACAC
AACCATTATCGACGGCGTAGGCGATGAAGCGCAAATCAAAGGTCGTGTAGCACAAATTCGTCAACAAATCGAAGAATCCACTTCCGATTA
CGACAAAGAAAAACTGCAAGAACGTGTGGCGAAACTTGCCGGCGGTGTCGCAGTCATTAAAGTCGGTGCGGCAACCGAAGTGGAAATGAA
AGAGAAAAAAGACCGCGTGGAAGACGCGTTGCACGCAACCCGCGCTGCGGTTGAAGAAGGTATCGTTGCCGGCGGCGGCGTCGCTTTAAT
TCGGGCTGCAAGCAAAGCGGCGGCAAATCTGCAAGGCGATAATGAAGAACAAAACGTCGGTATCAAACTGGCATTACGTGCAATGGAAGC
GCCGCTTCGTCAAATCGTAGCCAATGCCGGCGAAGAAGCTTCCGTGGTTGCCAGCGCAGTGAAAAACGGCGAAGGTAACTACGGTTATAA
TGCCGGTACGGAAGAATACGGCGATATGATCGCAATGGGTATTTTGGATCCGACTAAAGTAACCCGTTCCGCATTACAATTCGCGGCATC
TATCGCAGGTTTAATGATTACCACTGAAGCGATGGTAACCGAATTGCCGAAAGACGATAAATTAGACCCGTCTGCAGCAATGGGCGGCAT
GGGTGGAATGGGCGGCATGATGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine49931 %
Guanine45728 %
Thyamine34421 %
Cytosine34421 %
A+T84352 %
G+C80149 %

Total Bases :   1644 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC3323
ACCACCACC26433
AAAAAA67223
AAAAAA117323
CGGCGGCGG123833

Microsatellite Map

ATGGCAGCAAAAGACGTTAAATTCGGTAATGATGCGCGCGTAAAAATGTTAGCGGGCGTAAACGTATTGGCAGATGCGGTAAAAGTGACC
TTAGGTCCTAAAGGTCGTAACGTGATTTTAGACAAATCTTTCGGCGCACCGACCATCACCAAAGACGGCGTTTCCGTTGCGCGTGAAATC
GAATTGGAAGATAAATTCGAAAACATGGGCGCACAAATGGTAAAAGAAGTGGCGTCTAAAGCAAATGATGCCGCGGGCGACGGTACCACC
ACCGCAACGGTTTTAGCGCAAGCTATTGTCAACGAAGGCTTAAAAGCCGTGGCGGCGGGTATGAACCCGATGGATTTAAAACGCGGTATC
GACAAAGCGGTGGCGGCAGTGGTATCCGAATTGAAAGCCCTTTCCAAACCTTGCGAAACGTCGAAAGAAATCGAACAGGTGGGGACGATT
TCCGCAAATAGTGACAGCATTGTCGGTCAATTAATCGCGCAAGCCATGGAAAAAGTAGGTAAAGAAGGCGTGATTACCGTTGAAGACGGC
ACCGGTCTGGAAGACGAATTGGATGTCGTTGAAGGTATGCAATTCGATCGCGGTTATTTATCGCCGTACTTCATCAACAAACCGGAAACC
GCAACGGTTGAAATGGATAATCCGTATATTTTATTGGTGGATAAAAAAATCTCCAATATCCGCGAATTATTACCGGTTTTAGAAGCCGTG
GCTAAAGCGGGCAAACCGTTATTAATCATCGCAGAAGATGTGGAAGGCGAAGCGTTGGCAACTTTAGTGGTTAACACCATGCGCGGTATC
GTGAAAGTGGCGGCGGTGAAAGCGCCGGGCTTCGGCGATCGTCGTAAAGCTATGTTGCAAGACATCGCAATTCTTACCGCCGGTACCGTC
ATTTCCGAAGAAATCGGTATGGAACTGGAAAAAGCCGCATTGGAAGATTTAGGTCAGGCTAAACGTGTCGTTATTAACAAAGACAACACA
ACCATTATCGACGGCGTAGGCGATGAAGCGCAAATCAAAGGTCGTGTAGCACAAATTCGTCAACAAATCGAAGAATCCACTTCCGATTAC
GACAAAGAAAAACTGCAAGAACGTGTGGCGAAACTTGCCGGCGGTGTCGCAGTCATTAAAGTCGGTGCGGCAACCGAAGTGGAAATGAAA
GAGAAAAAAGACCGCGTGGAAGACGCGTTGCACGCAACCCGCGCTGCGGTTGAAGAAGGTATCGTTGCCGGCGGCGGCGTCGCTTTAATT
CGGGCTGCAAGCAAAGCGGCGGCAAATCTGCAAGGCGATAATGAAGAACAAAACGTCGGTATCAAACTGGCATTACGTGCAATGGAAGCG
CCGCTTCGTCAAATCGTAGCCAATGCCGGCGAAGAAGCTTCCGTGGTTGCCAGCGCAGTGAAAAACGGCGAAGGTAACTACGGTTATAAT
GCCGGTACGGAAGAATACGGCGATATGATCGCAATGGGTATTTTGGATCCGACTAAAGTAACCCGTTCCGCATTACAATTCGCGGCATCT
ATCGCAGGTTTAATGATTACCACTGAAGCGATGGTAACCGAATTGCCGAAAGACGATAAATTAGACCCGTCTGCAGCAATGGGCGGCATG
GGTGGAATGGGCGGCATGATGTAA

Gene Information
Molecule Type genomic DNA
Bases 1644 Bases
Molecular Weight510801.52 Da
Coding Sequence complement(CP000746.1:721475..723118)
NCBI ReferenceABR74035
NotesTIGRFAM: chaperonin GroEL; PFAM: chaperonin

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 4 to 524 521 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACSU1

Accession Number

HSP60_0023

Added on

2012-02-02

Updated On

2014-01-20