Help  Custom Search
 
10 kDa chaperonin. of Actinobacillus pleuropneumoniae serotype 5b (str. L20)

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

10 kDa chaperonin.

Synonymous Names

CH10_ACTP2, Cpn10, 10 kDa protein, GroES protein.

Gene names

Gene Name

groES

Gene Locus Tag

APL_1013

Gene Identifier

4848835

Taxon Information

Organism

Actinobacillus pleuropneumoniae serotype 5b (str. L20)

Organism ID

416269 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus pleuropneumoniae serovar 5b str. L20

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MTLRPLHDKVILKREEVETRSAGGIVLTGSAATKSTRGKVIAVGTGRLFENGSVQALAVKVGDVVIFNEG YGVKSEKIDGEEVLILSENDILAIVE

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACTCTTCGTCCATTACACGATAAAGTAATTTTAAAACGTGAAGAAGTGGAAACACGTTCTGCAGGCGGTATTGTTTTAACCGGTTC
GGCAGCGACGAAATCTACGCGCGGTAAAGTAATTGCGGTTGGTACAGGTCGTTTATTCGAAAACGGTTCCGTACAAGCATTAGCGGTAAA
AGTTGGTGATGTCGTTATCTTCAACGAAGGTTATGGGGTTAAATCAGAAAAAATTGACGGCGAAGAAGTGTTAATTCTTTCTGAAAACGA
TATTTTAGCTATCGTAGAGTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine8931 %
Guanine7326 %
Thyamine8429 %
Cytosine4516 %
A+T17360 %
G+C11841 %

Total Bases :   291 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG10623
AAAAAA22623

Microsatellite Map

ATGACTCTTCGTCCATTACACGATAAAGTAATTTTAAAACGTGAAGAAGTGGAAACACGTTCTGCAGGCGGTATTGTTTTAACCGGTTCG
GCAGCGACGAAATCTACGCGCGGTAAAGTAATTGCGGTTGGTACAGGTCGTTTATTCGAAAACGGTTCCGTACAAGCATTAGCGGTAAAA
GTTGGTGATGTCGTTATCTTCAACGAAGGTTATGGGGTTAAATCAGAAAAAATTGACGGCGAAGAAGTGTTAATTCTTTCTGAAAACGAT
ATTTTAGCTATCGTAGAGTAG

Gene Information
Molecule Type genomic DNA
Bases 291 Bases
Molecular Weight90411.96 Da
Coding Sequence complement(CP000569.1:1179740..1180030)
NCBI ReferenceABN74107
Notespubmed:9037757

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 2 to 95 94 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACPL1

Accession Number

HSP60_0022

Added on

2012-02-02

Updated On

2014-01-20