Help  Custom Search
 
60 kDa chaperonin. of Actinobacillus pleuropneumoniae serotype 5b (str. L20)

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

60 kDa chaperonin.

Synonymous Names

CH60_ACTP2, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

APL_1012

Gene Identifier

4849874

Taxon Information

Organism

Actinobacillus pleuropneumoniae serotype 5b (str. L20)

Organism ID

416269 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus pleuropneumoniae serovar 5b str. L20

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREIELEDKFENMG AQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVVAVVEELKAISKPCET SKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDGTGLDDALDVVEGMQFDRGYLSPYFINKPEA GTVELENPYIILVDKKISNIREILPVLEAVAKAGKPLLIVAEDIEGEALATLVVNTMRGIVKVAAVKAPG FGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEELGQAKRVVITKDNTTIIDGIGDEAQIKARVAQIR QQIEDSTSDYDKEKLQERVAKLACGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALV RAASKVAATLTGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVARNVKDGNGNYGYNAGTEQYGDML EMGILDPTKVTRSALQFAASIAGLMITTECMITDLPKEEKLDPAAAMGGMGGMGGMI

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAGCAAAAGACGTTAAATTCGGTAATGACGCACGTGTAAAAATGTTAAAAGGCGTGAATGTTTTAGCGGATGCGGTAAAAGTAAC
TTTAGGCCCGAAAGGTCGTAATGTCGTATTAGATAAAGCATACGGCGCACCAACCATCACTAAAGACGGCGTGTCGGTTGCACGTGAAAT
CGAATTGGAAGATAAATTCGAGAATATGGGCGCACAAATGGTAAAAGAAGTGGCGTCAAAAGCGAACGATGCGGCCGGTGACGGTACGAC
AACCGCAACTGTTCTTGCTCAAGCAATCGTAAACGAAGGCTTAAAAGCAGTAGCGGCAGGTATGAATCCGATGGACTTAAAACGCGGTAT
CGATAAAGCGGTTGTTGCTGTAGTGGAAGAATTAAAAGCGATTTCTAAGCCGTGCGAAACTTCAAAAGAAATTGAGCAAGTAGGTACGAT
TTCAGCAAACTCTGATGAAACCGTAGGTAAACTAATTGCGCAAGCAATGGAAAAAGTCGGTAAAGAAGGCGTTATCACCGTTGAAGACGG
TACAGGTTTAGATGATGCGTTAGATGTGGTAGAAGGTATGCAATTTGACCGTGGTTACCTTTCTCCATACTTCATCAACAAACCGGAAGC
CGGTACGGTTGAATTAGAAAATCCATACATTATTTTAGTCGATAAAAAAATCAGCAACATTCGTGAAATCTTACCGGTATTAGAAGCGGT
AGCGAAAGCGGGTAAACCGTTATTAATCGTAGCGGAAGATATCGAAGGCGAAGCGTTAGCAACATTAGTGGTAAATACTATGCGAGGTAT
CGTGAAAGTGGCTGCGGTAAAAGCACCGGGCTTTGGCGATCGTCGTAAAGCAATGTTACAAGATATTGCAATTTTAACCGCAGGTACTGT
GATTTCGGAAGAAATCGGTATGGAACTTGAGAAAGCGACTCTCGAAGAATTAGGTCAAGCAAAACGTGTTGTGATCACAAAAGATAACAC
AACCATTATTGACGGTATCGGTGACGAAGCGCAAATCAAAGCACGAGTAGCGCAAATTCGCCAACAAATTGAAGATTCGACATCAGATTA
CGATAAAGAAAAACTTCAAGAGCGTGTTGCAAAATTAGCCTGTGGTGTTGCGGTAATCAAAGTAGGTGCGGCAACCGAAGTGGCGATGAA
AGAGAAAAAAGATCGTGTTGATGATGCGTTACACGCAACTCGTGCGGCAGTTGAAGAAGGTATTGTACCGGGAGGCGGTGTTGCGTTAGT
GCGTGCGGCTTCTAAAGTTGCGGCTACTTTAACAGGTGATAACGAAGAGCAAAATGTCGGTATCAAACTTGCGCTTCGTGCGATGGAAGC
ACCGCTTCGCCAAATCGTGACTAACGCAGGCGAAGAAGCGTCCGTTGTGGCTCGTAATGTGAAAGACGGTAACGGTAACTACGGTTATAA
TGCCGGTACGGAACAATACGGCGATATGCTTGAGATGGGTATCTTAGATCCGACAAAAGTAACTCGTTCGGCATTACAATTCGCAGCATC
AATTGCAGGTTTAATGATCACGACAGAATGTATGATCACAGATTTACCGAAAGAGGAAAAATTAGATCCGGCTGCAGCAATGGGCGGCAT
GGGTGGTATGGGCGGAATGATATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine53933 %
Guanine44027 %
Thyamine37723 %
Cytosine28818 %
A+T91656 %
G+C72845 %

Total Bases :   1644 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA67223
AAAAAA117323

Microsatellite Map

ATGGCAGCAAAAGACGTTAAATTCGGTAATGACGCACGTGTAAAAATGTTAAAAGGCGTGAATGTTTTAGCGGATGCGGTAAAAGTAACT
TTAGGCCCGAAAGGTCGTAATGTCGTATTAGATAAAGCATACGGCGCACCAACCATCACTAAAGACGGCGTGTCGGTTGCACGTGAAATC
GAATTGGAAGATAAATTCGAGAATATGGGCGCACAAATGGTAAAAGAAGTGGCGTCAAAAGCGAACGATGCGGCCGGTGACGGTACGACA
ACCGCAACTGTTCTTGCTCAAGCAATCGTAAACGAAGGCTTAAAAGCAGTAGCGGCAGGTATGAATCCGATGGACTTAAAACGCGGTATC
GATAAAGCGGTTGTTGCTGTAGTGGAAGAATTAAAAGCGATTTCTAAGCCGTGCGAAACTTCAAAAGAAATTGAGCAAGTAGGTACGATT
TCAGCAAACTCTGATGAAACCGTAGGTAAACTAATTGCGCAAGCAATGGAAAAAGTCGGTAAAGAAGGCGTTATCACCGTTGAAGACGGT
ACAGGTTTAGATGATGCGTTAGATGTGGTAGAAGGTATGCAATTTGACCGTGGTTACCTTTCTCCATACTTCATCAACAAACCGGAAGCC
GGTACGGTTGAATTAGAAAATCCATACATTATTTTAGTCGATAAAAAAATCAGCAACATTCGTGAAATCTTACCGGTATTAGAAGCGGTA
GCGAAAGCGGGTAAACCGTTATTAATCGTAGCGGAAGATATCGAAGGCGAAGCGTTAGCAACATTAGTGGTAAATACTATGCGAGGTATC
GTGAAAGTGGCTGCGGTAAAAGCACCGGGCTTTGGCGATCGTCGTAAAGCAATGTTACAAGATATTGCAATTTTAACCGCAGGTACTGTG
ATTTCGGAAGAAATCGGTATGGAACTTGAGAAAGCGACTCTCGAAGAATTAGGTCAAGCAAAACGTGTTGTGATCACAAAAGATAACACA
ACCATTATTGACGGTATCGGTGACGAAGCGCAAATCAAAGCACGAGTAGCGCAAATTCGCCAACAAATTGAAGATTCGACATCAGATTAC
GATAAAGAAAAACTTCAAGAGCGTGTTGCAAAATTAGCCTGTGGTGTTGCGGTAATCAAAGTAGGTGCGGCAACCGAAGTGGCGATGAAA
GAGAAAAAAGATCGTGTTGATGATGCGTTACACGCAACTCGTGCGGCAGTTGAAGAAGGTATTGTACCGGGAGGCGGTGTTGCGTTAGTG
CGTGCGGCTTCTAAAGTTGCGGCTACTTTAACAGGTGATAACGAAGAGCAAAATGTCGGTATCAAACTTGCGCTTCGTGCGATGGAAGCA
CCGCTTCGCCAAATCGTGACTAACGCAGGCGAAGAAGCGTCCGTTGTGGCTCGTAATGTGAAAGACGGTAACGGTAACTACGGTTATAAT
GCCGGTACGGAACAATACGGCGATATGCTTGAGATGGGTATCTTAGATCCGACAAAAGTAACTCGTTCGGCATTACAATTCGCAGCATCA
ATTGCAGGTTTAATGATCACGACAGAATGTATGATCACAGATTTACCGAAAGAGGAAAAATTAGATCCGGCTGCAGCAATGGGCGGCATG
GGTGGTATGGGCGGAATGATATAA

Gene Information
Molecule Type genomic DNA
Bases 1644 Bases
Molecular Weight511577.87 Da
Coding Sequence complement(CP000569.1:1178033..1179676)
NCBI ReferenceABN74106
Notespubmed:9037757

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 4 to 524 521 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACPL1

Accession Number

HSP60_0021

Added on

2012-02-02

Updated On

2014-01-20