Help  Custom Search
 
chaperonin GroS. of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin GroS.

Synonymous Names

CH10_ACIB5, Cpn10, 10 kDa protein, GroES protein.

Gene names

Gene Name

groES

Gene Locus Tag

AB57_3080

Gene Identifier

7046541

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MSNIRPLHDRVVIRRVEEETKTAGGILLPGSAAEKPSQGEVIAVGNGQITDNGVRALDVKVGDKVLFGTY AGTTVKVNGEELLIMKESDILAVLEG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGCAACATTCGTCCATTACATGATCGCGTTGTGATTCGTCGCGTAGAAGAAGAAACCAAAACTGCTGGCGGTATTTTATTGCCAGG
TTCTGCTGCTGAAAAACCATCTCAAGGTGAAGTAATTGCAGTAGGCAATGGTCAAATCACTGATAACGGCGTACGTGCTTTGGATGTTAA
AGTTGGTGACAAGGTGTTATTTGGTACTTATGCAGGTACAACAGTTAAAGTAAATGGTGAAGAACTCTTAATCATGAAAGAGTCAGACAT
CTTAGCTGTATTAGAAGGCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine9132 %
Guanine7125 %
Thyamine8229 %
Cytosine4717 %
A+T17360 %
G+C11841 %

Total Bases :   291 bases

Microsatellites
SequencePosition LengthRepeats
AGAAGAAGA4733
CTGCTGCTG9133

Microsatellite Map

ATGAGCAACATTCGTCCATTACATGATCGCGTTGTGATTCGTCGCGTAGAAGAAGAAACCAAAACTGCTGGCGGTATTTTATTGCCAGGT
TCTGCTGCTGAAAAACCATCTCAAGGTGAAGTAATTGCAGTAGGCAATGGTCAAATCACTGATAACGGCGTACGTGCTTTGGATGTTAAA
GTTGGTGACAAGGTGTTATTTGGTACTTATGCAGGTACAACAGTTAAAGTAAATGGTGAAGAACTCTTAATCATGAAAGAGTCAGACATC
TTAGCTGTATTAGAAGGCTAA

Gene Information
Molecule Type genomic DNA
Bases 291 Bases
Molecular Weight90349.92 Da
Coding Sequence complement(CP001182.1:3177744..3178034)
NCBI ReferenceACJ42412
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 3 to 94 92 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACBA1

Accession Number

HSP60_0020

Added on

2012-02-02

Updated On

2014-01-20