Help  Custom Search
 
chaperonin GroL. of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin GroL.

Synonymous Names

CH60_ACIB5, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

AB57_3079

Gene Identifier

7046540

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEISLKDKFENMG AQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGIDIAVKTVVENIRSIAKPADD FKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEGSGFEDALDVVEGMQFDRGYISPYFANKQDT LTAELENPFILLVDKKISNIRELISVLEAVAKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPG FGDRRKAMLQDIAILTGATVISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAAIAERVQQIR AQIEESTSEYDREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV RAVNALEGLKGANEDQTAGINILRRAIEAPLRQIVANAGDEPSVVINAVKNGEGNFGYNAATGEYGDMLE MGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAAPDMGGMGGMGGMM

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCAGCTAAAGACGTAAAATTTGGTGATTCAGCTCGCTCAAAAATGATTGCAGGGGTAAACGTACTTGCAGATGCGGTTAAAGTGAC
TTTAGGTCCTAAAGGCCGTAATGTTGTGATCGACCGCTCTTTCGGCGCGCCGCACATCACTAAAGACGGTGTAACTGTTGCAAAAGAAAT
TTCATTAAAAGACAAGTTTGAAAACATGGGTGCTCAACTTGTTCGTGAAGTTTCAAGCAAAACTAACGACATCGCAGGTGACGGTACAAC
AACTGCAACTGTACTTGCTCAAGCAATTTTAAATGAAGGTATCAAATCAGTAACTGCTGGTATGAACCCAATGGATTTAAAACGCGGTAT
CGACATTGCAGTAAAAACTGTAGTTGAAAATATCCGTTCTATTGCTAAACCAGCTGATGATTTCAAAGCAATTGAACAAGTAGGTTCAAT
CTCTGCTAACTCTGATACTACTGTTGGTAAACTTATTGCTCAAGCAATGGAAAAAGTAGGTAAAGAAGGCGTAATCACTGTAGAAGAAGG
TTCTGGCTTCGAAGACGCATTAGACGTTGTAGAAGGTATGCAGTTTGACCGTGGTTATATCTCTCCGTACTTTGCAAACAAACAAGATAC
TTTAACTGCTGAACTTGAAAATCCGTTCATTCTTCTTGTTGATAAAAAAATCAGCAACATTCGTGAATTGATTTCTGTTTTAGAAGCAGT
TGCTAAAACTGGTAAACCACTTCTTATCATCGCTGAAGATGTTGAAGGTGAAGCGCTTGCAACTCTTGTTGTAAACAACATGCGCGGTAT
CATCAAAGTATGTGCTGTTAAAGCTCCTGGTTTCGGTGACCGTCGTAAAGCAATGCTTCAAGATATCGCGATCTTGACTGGCGCAACAGT
TATTTCTGAAGAAGTTGGTATGTCTTTAGAACAAGCAACTCTTCAAGATTTAGGTACAGCGCACAAAATCACTGTTTCTAAAGAAAACAC
AGTTATTGTTGACGGTGCTGGTGATGCTGCTGCTATCGCTGAGCGTGTTCAACAAATCCGTGCTCAAATCGAAGAGTCTACTTCAGAATA
TGACCGTGAAAAATTACAAGAACGTGTTGCTAAGTTAGCAGGCGGTGTTGCTGTAATTAAAATCGGTGCAGCAACTGAAGTTGAAATGAA
AGAGAAGAAAGACCGCGTAGACGACGCACTTCACGCAACTCGTGCAGCAGTTGAAGAAGGTGTTGTTGCTGGTGGTGGTGTTGCTCTTGT
TCGCGCTGTAAATGCTCTTGAAGGCTTAAAAGGCGCTAACGAAGATCAAACAGCTGGTATCAACATTTTACGCCGTGCGATCGAAGCTCC
ACTTCGTCAAATCGTTGCGAATGCTGGTGATGAGCCATCTGTAGTTATCAACGCTGTTAAGAATGGTGAAGGTAACTTCGGTTACAACGC
TGCAACTGGCGAATATGGTGATATGTTAGAAATGGGTATCCTTGACCCAGCTAAAGTAACTCGTTCTGCACTTGAGCACGCTGCTTCTGT
TGCTGGCTTAATGTTAACTACAGAATGTATGATTACTGACATTCCTGAAGACAAACCAGCTGCTCCAGATATGGGCGGTATGGGTGGTAT
GGGCGGAATGATGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine49331 %
Guanine38224 %
Thyamine45528 %
Cytosine30519 %
A+T94858 %
G+C68743 %

Total Bases :   1635 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC13323
TCTCTC59823
AAAAAA67223
TGCTGCTGC101333
TGGTGGTGG123833

Microsatellite Map

ATGTCAGCTAAAGACGTAAAATTTGGTGATTCAGCTCGCTCAAAAATGATTGCAGGGGTAAACGTACTTGCAGATGCGGTTAAAGTGACT
TTAGGTCCTAAAGGCCGTAATGTTGTGATCGACCGCTCTTTCGGCGCGCCGCACATCACTAAAGACGGTGTAACTGTTGCAAAAGAAATT
TCATTAAAAGACAAGTTTGAAAACATGGGTGCTCAACTTGTTCGTGAAGTTTCAAGCAAAACTAACGACATCGCAGGTGACGGTACAACA
ACTGCAACTGTACTTGCTCAAGCAATTTTAAATGAAGGTATCAAATCAGTAACTGCTGGTATGAACCCAATGGATTTAAAACGCGGTATC
GACATTGCAGTAAAAACTGTAGTTGAAAATATCCGTTCTATTGCTAAACCAGCTGATGATTTCAAAGCAATTGAACAAGTAGGTTCAATC
TCTGCTAACTCTGATACTACTGTTGGTAAACTTATTGCTCAAGCAATGGAAAAAGTAGGTAAAGAAGGCGTAATCACTGTAGAAGAAGGT
TCTGGCTTCGAAGACGCATTAGACGTTGTAGAAGGTATGCAGTTTGACCGTGGTTATATCTCTCCGTACTTTGCAAACAAACAAGATACT
TTAACTGCTGAACTTGAAAATCCGTTCATTCTTCTTGTTGATAAAAAAATCAGCAACATTCGTGAATTGATTTCTGTTTTAGAAGCAGTT
GCTAAAACTGGTAAACCACTTCTTATCATCGCTGAAGATGTTGAAGGTGAAGCGCTTGCAACTCTTGTTGTAAACAACATGCGCGGTATC
ATCAAAGTATGTGCTGTTAAAGCTCCTGGTTTCGGTGACCGTCGTAAAGCAATGCTTCAAGATATCGCGATCTTGACTGGCGCAACAGTT
ATTTCTGAAGAAGTTGGTATGTCTTTAGAACAAGCAACTCTTCAAGATTTAGGTACAGCGCACAAAATCACTGTTTCTAAAGAAAACACA
GTTATTGTTGACGGTGCTGGTGATGCTGCTGCTATCGCTGAGCGTGTTCAACAAATCCGTGCTCAAATCGAAGAGTCTACTTCAGAATAT
GACCGTGAAAAATTACAAGAACGTGTTGCTAAGTTAGCAGGCGGTGTTGCTGTAATTAAAATCGGTGCAGCAACTGAAGTTGAAATGAAA
GAGAAGAAAGACCGCGTAGACGACGCACTTCACGCAACTCGTGCAGCAGTTGAAGAAGGTGTTGTTGCTGGTGGTGGTGTTGCTCTTGTT
CGCGCTGTAAATGCTCTTGAAGGCTTAAAAGGCGCTAACGAAGATCAAACAGCTGGTATCAACATTTTACGCCGTGCGATCGAAGCTCCA
CTTCGTCAAATCGTTGCGAATGCTGGTGATGAGCCATCTGTAGTTATCAACGCTGTTAAGAATGGTGAAGGTAACTTCGGTTACAACGCT
GCAACTGGCGAATATGGTGATATGTTAGAAATGGGTATCCTTGACCCAGCTAAAGTAACTCGTTCTGCACTTGAGCACGCTGCTTCTGTT
GCTGGCTTAATGTTAACTACAGAATGTATGATTACTGACATTCCTGAAGACAAACCAGCTGCTCCAGATATGGGCGGTATGGGTGGTATG
GGCGGAATGATGTAA

Gene Information
Molecule Type genomic DNA
Bases 1635 Bases
Molecular Weight506719.69 Da
Coding Sequence complement(CP001182.1:3176051..3177685)
NCBI ReferenceACJ42411
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 4 to 523 520 GroEL/cpn60 chaperonin domain PF00118
Cd03344
Coiled coil 339 to 367 29 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACBA1

Accession Number

HSP60_0019

Added on

2012-02-02

Updated On

2014-01-20