Help  Custom Search
 
chaperonin Cpn10. of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin Cpn10.

Synonymous Names

A0LVJ2_ACIC1, Cpn10, 10 kDa protein, GroES protein.

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MERTATGVPIKLLHDRVLVKAEGPAGERRSTGGIVIPATASVGRRLVWAEVVGVGQTVRSVQPGDRVLYE PEDRAQIEIHGVSYVLLRERDIHAVAAERVEGSTGLYL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGAGCGTACCGCAACAGGTGTTCCGATCAAGCTGTTGCATGACCGCGTTCTCGTCAAGGCGGAGGGGCCGGCAGGGGAGCGCCGTTC
GACCGGCGGCATCGTAATTCCGGCAACCGCGTCGGTAGGACGGCGACTGGTGTGGGCGGAAGTCGTCGGAGTCGGGCAGACGGTCCGCTC
GGTGCAGCCGGGAGACCGGGTCCTGTACGAGCCGGAAGACCGGGCGCAGATCGAAATTCACGGCGTCTCCTACGTTCTGCTTCGCGAGCG
TGACATTCACGCCGTCGCTGCCGAGCGGGTCGAAGGCTCAACGGGTTTGTATCTGTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine5618 %
Guanine12138 %
Thyamine5919 %
Cytosine9128 %
A+T11536 %
G+C21265 %

Total Bases :   327 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGGAGCGTACCGCAACAGGTGTTCCGATCAAGCTGTTGCATGACCGCGTTCTCGTCAAGGCGGAGGGGCCGGCAGGGGAGCGCCGTTCG
ACCGGCGGCATCGTAATTCCGGCAACCGCGTCGGTAGGACGGCGACTGGTGTGGGCGGAAGTCGTCGGAGTCGGGCAGACGGTCCGCTCG
GTGCAGCCGGGAGACCGGGTCCTGTACGAGCCGGAAGACCGGGCGCAGATCGAAATTCACGGCGTCTCCTACGTTCTGCTTCGCGAGCGT
GACATTCACGCCGTCGCTGCCGAGCGGGTCGAAGGCTCAACGGGTTTGTATCTGTAG

Gene Information
Molecule Type genomic DNA
Bases 327 Bases
Molecular Weight101575.39 Da
Coding Sequence complement(CP000481.1:1892061..1892387)
NCBI ReferenceABK53452
NotesPFAM: chaperonin Cpn10; KEGG: sco:SCO2899 putative

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 9 to 96 88 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACCE2

Accession Number

HSP60_0018

Added on

2012-02-02

Updated On

2014-01-20