Help  Custom Search
 
chaperonin Cpn10. of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin Cpn10.

Synonymous Names

A0LRS6_ACIC1, Cpn10, 10 kDa protein, GroES protein.

Gene names

Gene Name

groS

Gene Locus Tag

Acel_0362

Gene Identifier

4485901

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MTTATSTRVAIRPLEDRILVKPVEAETTTASGLVIPDTAKEKPQEGVVLAVGPGRYEDGKRIPLDVKEGD RVLYSKYGGTEVKYNNEEYLVLSARDVLAVIE

FASTA Format Composition Secondary Structure

Nucleotide
 GTGACGACCGCCACCAGTACCCGGGTTGCTATTCGTCCCTTGGAGGACCGGATCCTCGTCAAGCCTGTCGAAGCGGAGACCACGACTGC
GTCGGGTCTGGTCATTCCGGACACGGCGAAGGAGAAGCCGCAGGAGGGCGTCGTGCTGGCCGTCGGCCCGGGGCGTTACGAAGACGGCAA
GCGGATTCCGCTCGATGTCAAGGAAGGCGACCGCGTCCTGTACAGCAAGTACGGCGGCACTGAGGTGAAGTACAACAACGAGGAGTACCT
CGTCCTGTCCGCCCGCGACGTGCTGGCCGTCATCGAGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine6221 %
Guanine10534 %
Thyamine5017 %
Cytosine9230 %
A+T11237 %
G+C19764 %

Total Bases :   309 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

GTGACGACCGCCACCAGTACCCGGGTTGCTATTCGTCCCTTGGAGGACCGGATCCTCGTCAAGCCTGTCGAAGCGGAGACCACGACTGCG
TCGGGTCTGGTCATTCCGGACACGGCGAAGGAGAAGCCGCAGGAGGGCGTCGTGCTGGCCGTCGGCCCGGGGCGTTACGAAGACGGCAAG
CGGATTCCGCTCGATGTCAAGGAAGGCGACCGCGTCCTGTACAGCAAGTACGGCGGCACTGAGGTGAAGTACAACAACGAGGAGTACCTC
GTCCTGTCCGCCCGCGACGTGCTGGCCGTCATCGAGTAA

Gene Information
Molecule Type genomic DNA
Bases 309 Bases
Molecular Weight95738.67 Da
Coding Sequence CP000481.1:372987..373295
NCBI ReferenceABK52136
NotesPFAM: chaperonin Cpn10; KEGG: sco:SCO4761 10 kD

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 10 to 101 92 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACCE1

Accession Number

HSP60_0017

Added on

2012-02-02

Updated On

2014-01-20