Help  Custom Search
 
Chaperonin GroEL. of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL.

Synonymous Names

CH602_ACIC1, Hsp60, Protein Cpn60 2, groEL protein 2.

Gene names

Gene Name

groEL2

Gene Locus Tag

Acel_0363

Gene Identifier

4485902

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MPKLLYYAEDARGALQRGVDHLADTVKVTLGPKGRNVVLATSGNKVTITNDGVTIAREIELDERDENLGA QLVKEVATKTNDVAGDGTTTATVLAQAMVREGLRNVAAGANPLALKRGIDAAVTAISDRLLAQAREVATK DEIANVATISAQDPAVGAVIADAFDKVGKDGVITVEESNTMGLELEFVEGLQFDKGYISPYFITDPERME AVLDNPYILLHEGKISNAMDFVPLLEKVVQAGRPLLVIAEDVEGDALATLVVNKIRGTFSSVAVKAPGFG DRRKAMLGDMAVLTGAQVVSPEVGLKLDEVGLEVLGTARRVRVTRDDTTIVEGGGSAEAIQDRIRQIRAQ IDQTDSDWDREKLQERLAKLAGGVAVIRVGAATEVELKEKKHRLEDAVSATRAAIEEGIVAGGGSALLHA SSALDSLELTGDEAVGASIVRKAAAEPLRWIAENAGFEGYVVCSRVRDLPVGHGFDAQTGEYTDLVARGI IDPVKVTRSALTNAASVVGLLLTTEAIVVDKPEEKPESAGHNHGHGHHHPH

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCCGAAATTGCTCTATTACGCCGAGGATGCGCGCGGTGCGCTTCAGCGGGGCGTCGACCACCTCGCTGACACGGTGAAGGTGACCCT
CGGCCCGAAGGGCCGCAACGTCGTACTTGCAACGTCCGGCAACAAGGTGACCATCACCAACGACGGGGTGACCATCGCCCGGGAGATCGA
GCTCGACGAACGGGACGAGAATCTCGGCGCCCAGCTGGTCAAAGAGGTTGCCACGAAGACCAACGATGTTGCCGGTGACGGGACGACGAC
CGCCACCGTGCTCGCGCAGGCGATGGTGCGGGAAGGCCTGCGCAACGTTGCGGCCGGGGCGAATCCGCTGGCGTTGAAGCGGGGAATTGA
TGCCGCGGTCACGGCCATCTCGGATCGGCTGTTGGCGCAGGCCCGCGAGGTCGCTACGAAGGACGAAATCGCCAACGTCGCCACGATCTC
CGCGCAGGACCCGGCCGTCGGCGCGGTGATCGCCGATGCCTTCGACAAGGTCGGCAAAGACGGTGTCATCACCGTCGAGGAGTCCAACAC
CATGGGACTGGAGCTCGAATTCGTCGAAGGGCTGCAATTCGACAAGGGCTACATTTCGCCGTACTTCATCACCGATCCTGAGCGGATGGA
AGCCGTCCTGGACAATCCGTACATCCTTCTGCACGAAGGAAAAATCAGCAACGCCATGGATTTCGTCCCGCTGCTGGAGAAAGTCGTGCA
AGCGGGCCGGCCGCTCCTGGTGATCGCCGAGGATGTCGAGGGTGACGCGCTGGCGACCCTGGTCGTGAACAAGATTCGGGGAACGTTCTC
CTCGGTGGCGGTCAAGGCGCCCGGATTCGGCGACCGCCGGAAGGCGATGCTCGGTGACATGGCGGTCCTCACCGGTGCGCAGGTGGTCTC
GCCGGAGGTCGGGCTCAAACTCGACGAGGTCGGCCTGGAGGTCTTGGGCACGGCCCGTCGGGTCCGGGTGACGCGTGACGACACCACGAT
CGTCGAAGGCGGCGGGTCCGCCGAGGCGATTCAAGACCGGATCCGTCAGATCCGCGCCCAGATCGACCAGACCGACTCGGACTGGGATCG
CGAGAAATTGCAGGAGCGGTTGGCCAAACTGGCCGGCGGTGTCGCGGTGATCCGGGTTGGTGCGGCGACCGAGGTTGAGCTGAAAGAGAA
GAAGCACCGGCTGGAGGACGCCGTCTCAGCGACCCGAGCTGCGATCGAGGAAGGCATCGTCGCGGGCGGTGGGTCCGCACTGTTGCACGC
GTCCAGCGCTCTTGACTCCCTGGAACTCACCGGCGACGAGGCGGTGGGTGCATCGATCGTGCGCAAAGCCGCGGCCGAACCGCTGCGCTG
GATTGCCGAGAACGCCGGATTCGAGGGGTACGTCGTCTGCAGCCGTGTCCGCGATCTTCCCGTCGGGCATGGCTTTGACGCGCAGACCGG
CGAGTACACCGACCTCGTCGCCCGAGGGATCATCGACCCGGTCAAGGTGACCAGGTCGGCGCTCACCAATGCCGCCTCCGTGGTCGGCTT
GCTGCTCACGACTGAAGCGATCGTGGTCGACAAGCCGGAGGAGAAGCCCGAATCCGCTGGCCATAACCACGGCCACGGGCATCATCACCC
GCACTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine31120 %
Guanine56235 %
Thyamine25616 %
Cytosine49731 %
A+T56735 %
G+C105966 %

Total Bases :   1626 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC3023
GACGACGAC26033

Microsatellite Map

ATGCCGAAATTGCTCTATTACGCCGAGGATGCGCGCGGTGCGCTTCAGCGGGGCGTCGACCACCTCGCTGACACGGTGAAGGTGACCCTC
GGCCCGAAGGGCCGCAACGTCGTACTTGCAACGTCCGGCAACAAGGTGACCATCACCAACGACGGGGTGACCATCGCCCGGGAGATCGAG
CTCGACGAACGGGACGAGAATCTCGGCGCCCAGCTGGTCAAAGAGGTTGCCACGAAGACCAACGATGTTGCCGGTGACGGGACGACGACC
GCCACCGTGCTCGCGCAGGCGATGGTGCGGGAAGGCCTGCGCAACGTTGCGGCCGGGGCGAATCCGCTGGCGTTGAAGCGGGGAATTGAT
GCCGCGGTCACGGCCATCTCGGATCGGCTGTTGGCGCAGGCCCGCGAGGTCGCTACGAAGGACGAAATCGCCAACGTCGCCACGATCTCC
GCGCAGGACCCGGCCGTCGGCGCGGTGATCGCCGATGCCTTCGACAAGGTCGGCAAAGACGGTGTCATCACCGTCGAGGAGTCCAACACC
ATGGGACTGGAGCTCGAATTCGTCGAAGGGCTGCAATTCGACAAGGGCTACATTTCGCCGTACTTCATCACCGATCCTGAGCGGATGGAA
GCCGTCCTGGACAATCCGTACATCCTTCTGCACGAAGGAAAAATCAGCAACGCCATGGATTTCGTCCCGCTGCTGGAGAAAGTCGTGCAA
GCGGGCCGGCCGCTCCTGGTGATCGCCGAGGATGTCGAGGGTGACGCGCTGGCGACCCTGGTCGTGAACAAGATTCGGGGAACGTTCTCC
TCGGTGGCGGTCAAGGCGCCCGGATTCGGCGACCGCCGGAAGGCGATGCTCGGTGACATGGCGGTCCTCACCGGTGCGCAGGTGGTCTCG
CCGGAGGTCGGGCTCAAACTCGACGAGGTCGGCCTGGAGGTCTTGGGCACGGCCCGTCGGGTCCGGGTGACGCGTGACGACACCACGATC
GTCGAAGGCGGCGGGTCCGCCGAGGCGATTCAAGACCGGATCCGTCAGATCCGCGCCCAGATCGACCAGACCGACTCGGACTGGGATCGC
GAGAAATTGCAGGAGCGGTTGGCCAAACTGGCCGGCGGTGTCGCGGTGATCCGGGTTGGTGCGGCGACCGAGGTTGAGCTGAAAGAGAAG
AAGCACCGGCTGGAGGACGCCGTCTCAGCGACCCGAGCTGCGATCGAGGAAGGCATCGTCGCGGGCGGTGGGTCCGCACTGTTGCACGCG
TCCAGCGCTCTTGACTCCCTGGAACTCACCGGCGACGAGGCGGTGGGTGCATCGATCGTGCGCAAAGCCGCGGCCGAACCGCTGCGCTGG
ATTGCCGAGAACGCCGGATTCGAGGGGTACGTCGTCTGCAGCCGTGTCCGCGATCTTCCCGTCGGGCATGGCTTTGACGCGCAGACCGGC
GAGTACACCGACCTCGTCGCCCGAGGGATCATCGACCCGGTCAAGGTGACCAGGTCGGCGCTCACCAATGCCGCCTCCGTGGTCGGCTTG
CTGCTCACGACTGAAGCGATCGTGGTCGACAAGCCGGAGGAGAAGCCCGAATCCGCTGGCCATAACCACGGCCACGGGCATCATCACCCG
CACTGA

Gene Information
Molecule Type genomic DNA
Bases 1626 Bases
Molecular Weight503960.03 Da
Coding Sequence CP000481.1:373385..375010
NCBI ReferenceABK52137
NotesTIGRFAM: chaperonin GroEL; PFAM: chaperonin

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 3 to 520 518 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACCE2

Accession Number

HSP60_0016

Added on

2012-02-02

Updated On

2014-01-20