Help  Custom Search
 
Chaperonin GroEL. of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL.

Synonymous Names

CH601_ACIC1, Hsp60, Protein Cpn60 1, groEL protein 1.

Gene names

Gene Name

groEL1

Gene Locus Tag

Acel_0101

Gene Identifier

4484544

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAKMIAFDEAARRALERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPYEKIGA ELVKEVAKKTDDVAGDGTTTATVLAQTLVREGLRNVAAGANPMALKRGIEAATERVCQALLEIAKDVETR EQIASTASISAGDTAVGEMIAEAMDKVGKEGVITVEESNTFGLELELTEGMRFDKGYISPYFVTDSERME AVLEDPYILIANQKISAVKDLLPVLEKVMQAGKPLAIIAEDVEGEALATLVVNKIRGTFRSVAVKAPGFG DRRKAMLGDIAVLTGGQVISEEVGLKLENVGLDLLGRARKVVVTKDETTIVEGAGDPEQIAGRVNQIRAE IEKTDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALLQA GKTAFEKLDLEGDEATGARIVELALEAPLKQIAINAGLEGGVVVEKVRSLEPGWGLNAQTGEYVDMIKAG IIDPAKVTRSALQNAASIAGLFLTTEAVVAEKPEKEKTPAAPGGGDMDF

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCCAAGATGATCGCGTTTGACGAGGCGGCTCGTCGCGCTCTCGAGCGCGGCATGAACCAGCTCGCTGACGCTGTCAAGGTGACGCT
CGGCCCGAAGGGTCGCAACGTCGTCCTGGAGAAGAAATGGGGCGCACCCACGATCACGAATGACGGGGTGAGCATCGCCAAGGAGATCGA
GCTCGAGGACCCCTACGAGAAGATCGGGGCTGAGCTCGTCAAGGAAGTTGCCAAGAAGACCGACGACGTCGCCGGTGACGGGACGACGAC
GGCAACTGTTCTCGCTCAGACCCTGGTACGCGAGGGTCTGCGGAACGTGGCCGCCGGCGCGAACCCGATGGCGCTCAAGCGCGGAATCGA
AGCGGCGACCGAGCGGGTCTGCCAGGCGCTGCTCGAGATAGCCAAGGACGTCGAGACCCGCGAGCAGATCGCGTCGACTGCGTCGATCTC
CGCCGGTGACACTGCCGTCGGCGAGATGATTGCCGAGGCGATGGACAAGGTCGGCAAGGAAGGCGTCATCACCGTTGAGGAGTCCAACAC
CTTCGGTCTGGAGCTTGAGCTCACCGAGGGAATGCGCTTCGACAAGGGGTACATCTCGCCGTACTTCGTGACCGACAGCGAGCGGATGGA
AGCGGTCCTCGAAGACCCGTACATTCTGATCGCGAACCAGAAGATCTCGGCGGTCAAGGACCTGCTGCCCGTCCTGGAGAAGGTCATGCA
GGCCGGGAAACCGCTCGCGATCATTGCCGAGGACGTCGAGGGCGAGGCGCTGGCGACGCTCGTCGTCAACAAGATCCGCGGTACCTTCCG
CTCGGTTGCCGTGAAGGCGCCCGGCTTCGGGGATCGGCGGAAGGCGATGCTCGGCGACATCGCGGTACTCACCGGCGGTCAGGTGATCAG
CGAAGAGGTCGGTCTGAAGCTGGAGAATGTCGGCCTCGACCTGCTCGGCCGGGCGCGCAAGGTCGTCGTCACCAAGGATGAGACGACGAT
CGTCGAGGGCGCTGGTGATCCGGAGCAGATCGCGGGCCGGGTCAACCAGATTCGCGCCGAGATCGAGAAGACCGACTCCGACTACGACCG
GGAGAAGCTGCAGGAGCGGCTCGCGAAGCTCGCGGGCGGCGTCGCGGTGATCAAGGTTGGTGCCGCCACCGAGGTCGAGCTCAAGGAGCG
CAAGCACCGCATCGAGGACGCCGTCCGGAATGCCAAGGCCGCGGTGGAGGAGGGCATCGTCGCTGGCGGCGGTGTGGCTCTGCTCCAGGC
GGGCAAGACGGCCTTCGAGAAGCTCGACCTTGAGGGTGACGAGGCAACCGGCGCCCGGATCGTTGAGCTGGCGCTCGAAGCCCCGCTGAA
GCAGATCGCGATCAACGCGGGTCTCGAGGGCGGGGTCGTCGTCGAGAAGGTGCGGAGCCTTGAGCCTGGCTGGGGTCTCAACGCCCAGAC
CGGTGAGTACGTCGACATGATCAAGGCGGGCATCATCGACCCGGCCAAGGTCACCCGGTCGGCGCTGCAGAACGCTGCGTCCATCGCCGG
ACTCTTCCTCACCACCGAGGCGGTGGTGGCGGAGAAGCCGGAGAAGGAGAAGACACCCGCAGCACCCGGCGGCGGCGACATGGACTTCTG
A 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine32420 %
Guanine58537 %
Thyamine23415 %
Cytosine47730 %
A+T55835 %
G+C106266 %

Total Bases :   1620 bases

Microsatellites
SequencePosition LengthRepeats
GACGACGAC26033
GCGCGC95123
GTCGTCGTC96033
GTCGTCGTC138333
CGGCGGCGG159533

Microsatellite Map

ATGGCCAAGATGATCGCGTTTGACGAGGCGGCTCGTCGCGCTCTCGAGCGCGGCATGAACCAGCTCGCTGACGCTGTCAAGGTGACGCTC
GGCCCGAAGGGTCGCAACGTCGTCCTGGAGAAGAAATGGGGCGCACCCACGATCACGAATGACGGGGTGAGCATCGCCAAGGAGATCGAG
CTCGAGGACCCCTACGAGAAGATCGGGGCTGAGCTCGTCAAGGAAGTTGCCAAGAAGACCGACGACGTCGCCGGTGACGGGACGACGACG
GCAACTGTTCTCGCTCAGACCCTGGTACGCGAGGGTCTGCGGAACGTGGCCGCCGGCGCGAACCCGATGGCGCTCAAGCGCGGAATCGAA
GCGGCGACCGAGCGGGTCTGCCAGGCGCTGCTCGAGATAGCCAAGGACGTCGAGACCCGCGAGCAGATCGCGTCGACTGCGTCGATCTCC
GCCGGTGACACTGCCGTCGGCGAGATGATTGCCGAGGCGATGGACAAGGTCGGCAAGGAAGGCGTCATCACCGTTGAGGAGTCCAACACC
TTCGGTCTGGAGCTTGAGCTCACCGAGGGAATGCGCTTCGACAAGGGGTACATCTCGCCGTACTTCGTGACCGACAGCGAGCGGATGGAA
GCGGTCCTCGAAGACCCGTACATTCTGATCGCGAACCAGAAGATCTCGGCGGTCAAGGACCTGCTGCCCGTCCTGGAGAAGGTCATGCAG
GCCGGGAAACCGCTCGCGATCATTGCCGAGGACGTCGAGGGCGAGGCGCTGGCGACGCTCGTCGTCAACAAGATCCGCGGTACCTTCCGC
TCGGTTGCCGTGAAGGCGCCCGGCTTCGGGGATCGGCGGAAGGCGATGCTCGGCGACATCGCGGTACTCACCGGCGGTCAGGTGATCAGC
GAAGAGGTCGGTCTGAAGCTGGAGAATGTCGGCCTCGACCTGCTCGGCCGGGCGCGCAAGGTCGTCGTCACCAAGGATGAGACGACGATC
GTCGAGGGCGCTGGTGATCCGGAGCAGATCGCGGGCCGGGTCAACCAGATTCGCGCCGAGATCGAGAAGACCGACTCCGACTACGACCGG
GAGAAGCTGCAGGAGCGGCTCGCGAAGCTCGCGGGCGGCGTCGCGGTGATCAAGGTTGGTGCCGCCACCGAGGTCGAGCTCAAGGAGCGC
AAGCACCGCATCGAGGACGCCGTCCGGAATGCCAAGGCCGCGGTGGAGGAGGGCATCGTCGCTGGCGGCGGTGTGGCTCTGCTCCAGGCG
GGCAAGACGGCCTTCGAGAAGCTCGACCTTGAGGGTGACGAGGCAACCGGCGCCCGGATCGTTGAGCTGGCGCTCGAAGCCCCGCTGAAG
CAGATCGCGATCAACGCGGGTCTCGAGGGCGGGGTCGTCGTCGAGAAGGTGCGGAGCCTTGAGCCTGGCTGGGGTCTCAACGCCCAGACC
GGTGAGTACGTCGACATGATCAAGGCGGGCATCATCGACCCGGCCAAGGTCACCCGGTCGGCGCTGCAGAACGCTGCGTCCATCGCCGGA
CTCTTCCTCACCACCGAGGCGGTGGTGGCGGAGAAGCCGGAGAAGGAGAAGACACCCGCAGCACCCGGCGGCGGCGACATGGACTTCTGA

Gene Information
Molecule Type genomic DNA
Bases 1620 Bases
Molecular Weight503127.59 Da
Coding Sequence CP000481.1:104887..106506
NCBI ReferenceABK51877
NotesTIGRFAM: chaperonin GroEL; PFAM: chaperonin

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 3 to 514 512 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACCE1

Accession Number

HSP60_0015

Added on

2012-02-02

Updated On

2014-01-20