Help  Custom Search
 
chaperonin, 10 kDa. of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin, 10 kDa.

Synonymous Names

C1F260_ACIC5, Cpn10, 10 kDa protein, GroES protein.

Gene names

Gene Name

groES

Gene Locus Tag

ACP_0720

Gene Identifier

7697997

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MATATVATTFTPLHDRILVRRIDEGETVRGGIIIPDSAKEKPQEGEVIAVGKGKSNDEGKVFPLDVKSGD RVLFGKYSGTEIKIDGEEFLIMREEEVLGILKK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAACGGCTACCGTAGCAACGACGTTCACCCCGCTCCATGACCGCATCCTGGTCCGCCGCATCGATGAAGGCGAGACGGTTCGCGG
CGGCATCATCATCCCCGACTCGGCCAAGGAAAAGCCGCAGGAAGGCGAAGTGATCGCTGTGGGCAAGGGCAAGAGCAACGACGAAGGCAA
GGTCTTCCCGCTGGATGTGAAGTCGGGCGACCGCGTGCTGTTCGGGAAGTACTCCGGCACCGAGATCAAGATCGACGGTGAAGAGTTCCT
GATCATGCGCGAAGAAGAAGTCCTCGGCATCCTCAAGAAGTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine7725 %
Guanine9932 %
Thyamine4816 %
Cytosine8829 %
A+T12541 %
G+C18760 %

Total Bases :   312 bases

Microsatellites
SequencePosition LengthRepeats
CATCATCAT9233
GAAGAAGAA27933

Microsatellite Map

ATGGCAACGGCTACCGTAGCAACGACGTTCACCCCGCTCCATGACCGCATCCTGGTCCGCCGCATCGATGAAGGCGAGACGGTTCGCGGC
GGCATCATCATCCCCGACTCGGCCAAGGAAAAGCCGCAGGAAGGCGAAGTGATCGCTGTGGGCAAGGGCAAGAGCAACGACGAAGGCAAG
GTCTTCCCGCTGGATGTGAAGTCGGGCGACCGCGTGCTGTTCGGGAAGTACTCCGGCACCGAGATCAAGATCGACGGTGAAGAGTTCCTG
ATCATGCGCGAAGAAGAAGTCCTCGGCATCCTCAAGAAGTAG

Gene Information
Molecule Type genomic DNA
Bases 312 Bases
Molecular Weight96696.44 Da
Coding Sequence CP001472.1:820659..820970
NCBI ReferenceACO34095
Notesidentified by match to protein family HMM PF00166

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 9 to 101 93 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACCA1

Accession Number

HSP60_0014

Added on

2012-02-02

Updated On

2014-01-20