Help  Custom Search
 
Chaperonin GroEL. of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL.

Synonymous Names

C1F261_ACIC5, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

ACP_0721

Gene Identifier

7699432

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAKQILHGEDSRQAILRGVNTLADAVKVTLGPKGRNVVIEKKFGSPTITKDGVTVAKEIELKDSLENMGA QMVREVASKTSDVAGDGTTTATVLAQAIYREGVKTVAAGANPMALKRGIDKAVESIVGKRDENGNVIGGA LSTFSKPVSGDMIAQVGTISANSDATIGTIIAEAMKKVGKDGVITVEESKTLETQLDVVEGMQFDRGYLS PYFVTDPDRMEAVLEDPYILIYEKKISTMKDLLPLLEQVARNGKPLVIIAEDVDGEALATLVVNKLRGTL NVAAVKAPGFGDRRKAMLGDIAILTGGNAITEDLGLKLENIKLEDLGRAKRVTIDKDNTTIVEGRGEDKA IEGRVKEIRSQVEKTTSDYDREKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDAMHATRAAVEEGI VPGGGVALVRCTPVVDELIKTLEGDEKIGAQIIRRAIEEPLRQIVGNAGEEGAVVVGKIHENKDTNYGYN AGSGVFEDLVKAGVIDPTKVTRTALLNASSIAGLMLTTEAMVAEIPEPKAAPAAPGHGGMEGMY

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAAAGCAGATTCTGCATGGAGAAGATTCCCGCCAGGCTATCCTGCGCGGTGTGAACACTCTGGCCGATGCAGTCAAGGTGACGCT
CGGCCCCAAGGGCCGCAATGTGGTGATTGAGAAGAAGTTCGGTTCGCCGACGATTACCAAGGACGGCGTGACCGTCGCCAAGGAGATCGA
GCTGAAGGATTCGCTCGAGAACATGGGCGCGCAGATGGTGCGCGAGGTGGCCTCGAAGACCTCTGACGTTGCCGGTGACGGCACCACCAC
CGCGACCGTGCTGGCTCAGGCCATCTATCGCGAGGGTGTCAAGACGGTGGCCGCCGGTGCGAACCCGATGGCTCTGAAGCGCGGCATCGA
TAAGGCTGTGGAGTCGATCGTGGGCAAGCGCGATGAAAACGGCAACGTGATTGGCGGCGCCCTGTCGACCTTCTCGAAGCCGGTTTCCGG
CGACATGATTGCCCAGGTGGGCACCATCTCGGCCAACAGTGACGCGACCATCGGCACCATCATCGCCGAGGCGATGAAGAAGGTTGGCAA
GGACGGCGTGATCACGGTCGAAGAGTCGAAGACGCTCGAGACCCAGCTCGATGTGGTCGAAGGCATGCAGTTTGACCGCGGCTACCTGAG
CCCCTACTTCGTGACCGATCCTGACCGCATGGAAGCCGTACTGGAAGATCCCTACATCCTGATCTATGAGAAGAAGATCAGCACCATGAA
GGATCTGCTGCCCCTGCTCGAGCAGGTTGCCCGCAACGGCAAGCCGCTCGTGATCATCGCTGAGGACGTGGACGGCGAAGCGCTGGCGAC
CCTGGTCGTCAACAAGCTGCGCGGCACGCTGAACGTGGCTGCGGTGAAGGCTCCTGGCTTCGGCGACCGCCGCAAGGCCATGCTGGGCGA
CATCGCCATCCTGACCGGCGGCAACGCGATCACCGAAGATCTGGGCCTGAAGCTTGAGAACATCAAGCTCGAAGACCTGGGCCGTGCCAA
GCGCGTCACCATCGACAAGGACAACACCACCATCGTCGAAGGCCGTGGCGAGGACAAGGCGATCGAAGGCCGCGTGAAGGAGATTCGCAG
CCAGGTCGAGAAGACCACCTCGGACTATGACCGCGAGAAGCTGCAGGAGCGCCTCGCCAAGCTGGTGGGCGGCGTGGCCGTCATCAAGGT
CGGTGCTGCTACCGAGACCGAGATGAAGGAGAAGAAGGCTCGCGTGGAAGACGCGATGCACGCAACCCGCGCGGCCGTGGAAGAGGGCAT
CGTTCCGGGCGGCGGTGTGGCGCTGGTTCGCTGCACCCCGGTGGTCGATGAGCTCATCAAGACGCTCGAAGGCGATGAGAAGATCGGTGC
ACAGATCATTCGCCGCGCCATCGAAGAGCCCCTGCGCCAGATTGTCGGCAACGCCGGCGAAGAAGGCGCTGTGGTGGTGGGCAAGATCCA
CGAGAACAAGGACACCAACTACGGCTATAACGCCGGATCGGGCGTCTTTGAGGATCTGGTCAAGGCCGGTGTCATCGACCCGACCAAGGT
CACCCGCACTGCCCTGCTGAATGCCTCCTCGATCGCCGGCCTGATGCTGACGACCGAAGCGATGGTCGCTGAGATTCCTGAGCCCAAGGC
GGCTCCGGCGGCTCCCGGCCATGGCGGCATGGAAGGCATGTACTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine36222 %
Guanine55434 %
Thyamine26316 %
Cytosine48630 %
A+T62538 %
G+C104063 %

Total Bases :   1665 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC20523
CACCACCAC26033
AGAAGAAGA69733
CGCGCG123623
GTGGTGGTG141933

Microsatellite Map

ATGGCAAAGCAGATTCTGCATGGAGAAGATTCCCGCCAGGCTATCCTGCGCGGTGTGAACACTCTGGCCGATGCAGTCAAGGTGACGCTC
GGCCCCAAGGGCCGCAATGTGGTGATTGAGAAGAAGTTCGGTTCGCCGACGATTACCAAGGACGGCGTGACCGTCGCCAAGGAGATCGAG
CTGAAGGATTCGCTCGAGAACATGGGCGCGCAGATGGTGCGCGAGGTGGCCTCGAAGACCTCTGACGTTGCCGGTGACGGCACCACCACC
GCGACCGTGCTGGCTCAGGCCATCTATCGCGAGGGTGTCAAGACGGTGGCCGCCGGTGCGAACCCGATGGCTCTGAAGCGCGGCATCGAT
AAGGCTGTGGAGTCGATCGTGGGCAAGCGCGATGAAAACGGCAACGTGATTGGCGGCGCCCTGTCGACCTTCTCGAAGCCGGTTTCCGGC
GACATGATTGCCCAGGTGGGCACCATCTCGGCCAACAGTGACGCGACCATCGGCACCATCATCGCCGAGGCGATGAAGAAGGTTGGCAAG
GACGGCGTGATCACGGTCGAAGAGTCGAAGACGCTCGAGACCCAGCTCGATGTGGTCGAAGGCATGCAGTTTGACCGCGGCTACCTGAGC
CCCTACTTCGTGACCGATCCTGACCGCATGGAAGCCGTACTGGAAGATCCCTACATCCTGATCTATGAGAAGAAGATCAGCACCATGAAG
GATCTGCTGCCCCTGCTCGAGCAGGTTGCCCGCAACGGCAAGCCGCTCGTGATCATCGCTGAGGACGTGGACGGCGAAGCGCTGGCGACC
CTGGTCGTCAACAAGCTGCGCGGCACGCTGAACGTGGCTGCGGTGAAGGCTCCTGGCTTCGGCGACCGCCGCAAGGCCATGCTGGGCGAC
ATCGCCATCCTGACCGGCGGCAACGCGATCACCGAAGATCTGGGCCTGAAGCTTGAGAACATCAAGCTCGAAGACCTGGGCCGTGCCAAG
CGCGTCACCATCGACAAGGACAACACCACCATCGTCGAAGGCCGTGGCGAGGACAAGGCGATCGAAGGCCGCGTGAAGGAGATTCGCAGC
CAGGTCGAGAAGACCACCTCGGACTATGACCGCGAGAAGCTGCAGGAGCGCCTCGCCAAGCTGGTGGGCGGCGTGGCCGTCATCAAGGTC
GGTGCTGCTACCGAGACCGAGATGAAGGAGAAGAAGGCTCGCGTGGAAGACGCGATGCACGCAACCCGCGCGGCCGTGGAAGAGGGCATC
GTTCCGGGCGGCGGTGTGGCGCTGGTTCGCTGCACCCCGGTGGTCGATGAGCTCATCAAGACGCTCGAAGGCGATGAGAAGATCGGTGCA
CAGATCATTCGCCGCGCCATCGAAGAGCCCCTGCGCCAGATTGTCGGCAACGCCGGCGAAGAAGGCGCTGTGGTGGTGGGCAAGATCCAC
GAGAACAAGGACACCAACTACGGCTATAACGCCGGATCGGGCGTCTTTGAGGATCTGGTCAAGGCCGGTGTCATCGACCCGACCAAGGTC
ACCCGCACTGCCCTGCTGAATGCCTCCTCGATCGCCGGCCTGATGCTGACGACCGAAGCGATGGTCGCTGAGATTCCTGAGCCCAAGGCG
GCTCCGGCGGCTCCCGGCCATGGCGGCATGGAAGGCATGTACTAA

Gene Information
Molecule Type genomic DNA
Bases 1665 Bases
Molecular Weight516248.48 Da
Coding Sequence CP001472.1:821041..822705
NCBI ReferenceACO33045
Notesidentified by similarity to SP:P31293; match to

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 3 to 532 530 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACCA1

Accession Number

HSP60_0013

Added on

2012-02-02

Updated On

2014-01-20