Help  Custom Search
 
chaperonin Cpn10. of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin Cpn10.

Synonymous Names

CH10_ACIF5, Cpn10, 10 kDa protein, GroES protein.

Gene names

Gene Name

groES

Gene Locus Tag

Lferr_0699

Gene Identifier

6876661

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MKLRPLHDRVVIRRLEEEQKTAGGIIIPDTAKEKPVRGEIVAAGHGKILEDGKVRALDVKTGDQVLFAKY AGTEIKVEGEELLVMREDDIMAVIEK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAAACTGCGTCCCTTACATGATCGCGTCGTCATTCGTCGTCTGGAAGAAGAGCAGAAGACTGCCGGTGGGATCATCATTCCCGACAC
CGCCAAAGAAAAACCGGTGCGGGGCGAAATCGTCGCTGCCGGCCATGGCAAAATTCTCGAAGACGGCAAAGTGCGCGCCCTCGACGTCAA
AACTGGTGATCAGGTGCTCTTCGCCAAATATGCCGGCACCGAGATCAAGGTCGAAGGTGAAGAACTGCTGGTGATGCGTGAAGACGACAT
CATGGCGGTCATCGAAAAGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine8028 %
Guanine8429 %
Thyamine5319 %
Cytosine7426 %
A+T13346 %
G+C15855 %

Total Bases :   291 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC16123

Microsatellite Map

ATGAAACTGCGTCCCTTACATGATCGCGTCGTCATTCGTCGTCTGGAAGAAGAGCAGAAGACTGCCGGTGGGATCATCATTCCCGACACC
GCCAAAGAAAAACCGGTGCGGGGCGAAATCGTCGCTGCCGGCCATGGCAAAATTCTCGAAGACGGCAAAGTGCGCGCCCTCGACGTCAAA
ACTGGTGATCAGGTGCTCTTCGCCAAATATGCCGGCACCGAGATCAAGGTCGAAGGTGAAGAACTGCTGGTGATGCGTGAAGACGACATC
ATGGCGGTCATCGAAAAGTAA

Gene Information
Molecule Type genomic DNA
Bases 291 Bases
Molecular Weight90170.4 Da
Coding Sequence complement(CP001132.1:654620..654910)
NCBI ReferenceACH82950
NotesPFAM: chaperonin Cpn10; KEGG: noc:Noc_2922

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 2 to 94 93 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACFE1

Accession Number

HSP60_0012

Added on

2012-02-02

Updated On

2014-01-20