Help  Custom Search
 
Chaperonin GroEL. of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL.

Synonymous Names

CH60_ACIF5, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

Lferr_0698

Gene Identifier

6876660

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MPAKQVAFAEHAREKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELADKFENMG AQMVKEVASQASDEAGDGTTTATVLAQAIIREGLKAVIAGMNPMDLKRGIDKSVIVVVEELKKQSKPCKT QKEVAQVGTISANSDDSIGKIIAEAMEKVGNEGVITVEEGSGLANELDVVEGMQFDRGYLSPYFVNNQDK MVAELENPYILLHDKKISSIRDMLPILEQVAKSSRPLLIVAEDVEGEALATLVVNTMRGIIKVAAVKAPG FGDRRKAMLEDMAILTGGRVVSEEIGMKLESTTLADLGQAKKIVIDKENTTMIDGAGQQSEIKARVEQIR RQMEDASSDYDREKLQERVAKLAGGVAVIKVGAGSEMEMKEKKARVEDALHATRAAVEEGIVPGGGVALV RARHALEGFKTANHDQDMGVAIIRRAIEEPLRQIVANAGGEGSVVLNKVVDGKDGYGYNAATDEYGDMFE MGVIDPTKVTRTALQKASSIAGLMITTEAMVTELPKKDDKSGGDMGDMGGGMGGMGGMGGF

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCCAGCCAAACAAGTAGCCTTTGCTGAACATGCCCGCGAGAAGATGTTGCGTGGCGTTAACGTACTCGCCGATGCCGTCAAGGTCAC
CTTGGGTCCCAAGGGTCGTAACGTGGTGCTCGACAAGTCTTTCGGCGCCCCCACCATTACCAAGGACGGCGTCTCCGTCGCCAAGGAAAT
CGAACTGGCTGACAAGTTCGAGAACATGGGCGCGCAGATGGTGAAAGAAGTCGCCTCCCAGGCCTCCGACGAAGCCGGTGACGGTACCAC
CACCGCCACCGTTCTGGCCCAGGCCATCATCCGCGAAGGCCTCAAGGCCGTCATCGCCGGCATGAACCCCATGGACCTGAAGCGCGGCAT
CGACAAATCGGTCATCGTCGTCGTCGAGGAGCTGAAGAAGCAATCCAAGCCCTGCAAGACCCAAAAGGAAGTGGCCCAGGTAGGTACCAT
CTCCGCCAACTCTGACGACTCCATCGGCAAGATCATTGCCGAAGCCATGGAGAAGGTCGGCAACGAAGGCGTCATCACCGTGGAAGAAGG
TTCCGGCCTCGCCAACGAGTTGGACGTCGTCGAAGGTATGCAGTTCGACCGCGGTTACCTCTCCCCCTACTTCGTCAACAACCAGGACAA
GATGGTTGCCGAACTGGAGAATCCCTATATCCTCCTGCACGACAAGAAAATTTCCTCCATCCGCGACATGCTGCCCATCCTGGAGCAGGT
CGCCAAGTCCAGTCGTCCGCTGCTGATCGTGGCCGAAGATGTCGAAGGCGAAGCGTTGGCCACTCTGGTCGTCAACACCATGCGCGGCAT
CATCAAGGTCGCTGCGGTCAAGGCCCCGGGTTTTGGTGATCGTCGCAAGGCGATGCTCGAGGACATGGCCATCCTGACCGGCGGCCGCGT
GGTCTCCGAAGAAATCGGCATGAAGCTGGAAAGCACCACCCTCGCCGATCTCGGCCAGGCCAAAAAGATTGTCATCGACAAGGAAAACAC
CACCATGATCGATGGCGCCGGTCAGCAGAGCGAGATCAAGGCGCGCGTTGAGCAGATCCGTCGTCAGATGGAAGATGCCAGCTCCGACTA
CGATCGCGAGAAGCTTCAGGAGCGCGTGGCCAAGCTGGCCGGTGGCGTTGCCGTCATCAAGGTCGGTGCCGGTTCCGAGATGGAAATGAA
GGAAAAGAAGGCCCGTGTCGAAGACGCCCTGCATGCTACCCGTGCGGCCGTCGAAGAAGGCATCGTCCCCGGCGGCGGTGTGGCGCTGGT
CCGTGCCCGTCATGCGCTGGAAGGCTTCAAGACCGCCAACCACGACCAGGACATGGGTGTTGCCATCATCCGTCGCGCCATCGAAGAGCC
GTTGCGTCAGATCGTCGCCAATGCCGGCGGTGAAGGCAGCGTGGTTCTGAACAAGGTTGTGGACGGTAAAGACGGCTACGGCTACAACGC
CGCGACCGACGAATATGGCGACATGTTCGAGATGGGCGTCATCGACCCGACCAAGGTCACCCGCACCGCGTTGCAGAAGGCCTCCAGCAT
TGCCGGCCTGATGATCACCACGGAAGCCATGGTCACCGAACTGCCGAAGAAAGACGACAAGTCCGGCGGCGATATGGGCGACATGGGCGG
CGGCATGGGCGGCATGGGTGGTATGGGCGGCTTCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine38023 %
Guanine50431 %
Thyamine27717 %
Cytosine49530 %
A+T65740 %
G+C99961 %

Total Bases :   1656 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC20823
ACCACCACC26433
TCGTCGTCGTCG37334
GCGCGC102923
CGGCGGCGG123833
GGCGGCGGC161433

Microsatellite Map

ATGCCAGCCAAACAAGTAGCCTTTGCTGAACATGCCCGCGAGAAGATGTTGCGTGGCGTTAACGTACTCGCCGATGCCGTCAAGGTCACC
TTGGGTCCCAAGGGTCGTAACGTGGTGCTCGACAAGTCTTTCGGCGCCCCCACCATTACCAAGGACGGCGTCTCCGTCGCCAAGGAAATC
GAACTGGCTGACAAGTTCGAGAACATGGGCGCGCAGATGGTGAAAGAAGTCGCCTCCCAGGCCTCCGACGAAGCCGGTGACGGTACCACC
ACCGCCACCGTTCTGGCCCAGGCCATCATCCGCGAAGGCCTCAAGGCCGTCATCGCCGGCATGAACCCCATGGACCTGAAGCGCGGCATC
GACAAATCGGTCATCGTCGTCGTCGAGGAGCTGAAGAAGCAATCCAAGCCCTGCAAGACCCAAAAGGAAGTGGCCCAGGTAGGTACCATC
TCCGCCAACTCTGACGACTCCATCGGCAAGATCATTGCCGAAGCCATGGAGAAGGTCGGCAACGAAGGCGTCATCACCGTGGAAGAAGGT
TCCGGCCTCGCCAACGAGTTGGACGTCGTCGAAGGTATGCAGTTCGACCGCGGTTACCTCTCCCCCTACTTCGTCAACAACCAGGACAAG
ATGGTTGCCGAACTGGAGAATCCCTATATCCTCCTGCACGACAAGAAAATTTCCTCCATCCGCGACATGCTGCCCATCCTGGAGCAGGTC
GCCAAGTCCAGTCGTCCGCTGCTGATCGTGGCCGAAGATGTCGAAGGCGAAGCGTTGGCCACTCTGGTCGTCAACACCATGCGCGGCATC
ATCAAGGTCGCTGCGGTCAAGGCCCCGGGTTTTGGTGATCGTCGCAAGGCGATGCTCGAGGACATGGCCATCCTGACCGGCGGCCGCGTG
GTCTCCGAAGAAATCGGCATGAAGCTGGAAAGCACCACCCTCGCCGATCTCGGCCAGGCCAAAAAGATTGTCATCGACAAGGAAAACACC
ACCATGATCGATGGCGCCGGTCAGCAGAGCGAGATCAAGGCGCGCGTTGAGCAGATCCGTCGTCAGATGGAAGATGCCAGCTCCGACTAC
GATCGCGAGAAGCTTCAGGAGCGCGTGGCCAAGCTGGCCGGTGGCGTTGCCGTCATCAAGGTCGGTGCCGGTTCCGAGATGGAAATGAAG
GAAAAGAAGGCCCGTGTCGAAGACGCCCTGCATGCTACCCGTGCGGCCGTCGAAGAAGGCATCGTCCCCGGCGGCGGTGTGGCGCTGGTC
CGTGCCCGTCATGCGCTGGAAGGCTTCAAGACCGCCAACCACGACCAGGACATGGGTGTTGCCATCATCCGTCGCGCCATCGAAGAGCCG
TTGCGTCAGATCGTCGCCAATGCCGGCGGTGAAGGCAGCGTGGTTCTGAACAAGGTTGTGGACGGTAAAGACGGCTACGGCTACAACGCC
GCGACCGACGAATATGGCGACATGTTCGAGATGGGCGTCATCGACCCGACCAAGGTCACCCGCACCGCGTTGCAGAAGGCCTCCAGCATT
GCCGGCCTGATGATCACCACGGAAGCCATGGTCACCGAACTGCCGAAGAAAGACGACAAGTCCGGCGGCGATATGGGCGACATGGGCGGC
GGCATGGGCGGCATGGGTGGTATGGGCGGCTTCTAA

Gene Information
Molecule Type genomic DNA
Bases 1656 Bases
Molecular Weight512287.18 Da
Coding Sequence complement(CP001132.1:652918..654573)
NCBI ReferenceACH82949
NotesTIGRFAM: chaperonin GroEL; PFAM: chaperonin

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 4 to 523 520 GroEL/cpn60 chaperonin domain PF00118
Cd03344
Coiled coil 337 to 367 31 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACFE1

Accession Number

HSP60_0011

Added on

2012-02-02

Updated On

2014-01-20