Help  Custom Search
 
chaperonin Cpn10. of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin Cpn10.

Synonymous Names

CH10_ACICJ, Cpn10, 10 kDa protein, GroES protein.

Gene names

Gene Name

groES

Gene Locus Tag

Acry_2504

Gene Identifier

5161496

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MKFRPLHDRVVVRRLNAEEKTAGGIIIPDTAKEKPMEGEVIAVGPGARNEAGAVVALDVKAGDRILFGKW SGTEVKIDGEELLIMKESDIMGIIEGTASKKKAA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAAATTCCGTCCCCTGCACGACCGCGTGGTCGTTCGCCGGCTGAACGCCGAGGAGAAGACCGCCGGCGGCATCATCATCCCCGACAC
CGCCAAGGAAAAGCCGATGGAAGGCGAGGTCATCGCCGTTGGCCCGGGTGCCCGCAACGAGGCCGGCGCCGTCGTGGCGCTCGACGTCAA
GGCCGGCGACCGCATCCTGTTCGGCAAGTGGTCGGGCACCGAGGTCAAGATCGACGGCGAAGAGCTGCTGATCATGAAGGAATCCGACAT
CATGGGCATCATCGAGGGTACGGCTTCGAAGAAGAAGGCCGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine6822 %
Guanine10634 %
Thyamine4414 %
Cytosine9731 %
A+T11236 %
G+C20365 %

Total Bases :   315 bases

Microsatellites
SequencePosition LengthRepeats
CATCATCAT7133
GAAGAAGAA29633

Microsatellite Map

ATGAAATTCCGTCCCCTGCACGACCGCGTGGTCGTTCGCCGGCTGAACGCCGAGGAGAAGACCGCCGGCGGCATCATCATCCCCGACACC
GCCAAGGAAAAGCCGATGGAAGGCGAGGTCATCGCCGTTGGCCCGGGTGCCCGCAACGAGGCCGGCGCCGTCGTGGCGCTCGACGTCAAG
GCCGGCGACCGCATCCTGTTCGGCAAGTGGTCGGGCACCGAGGTCAAGATCGACGGCGAAGAGCTGCTGATCATGAAGGAATCCGACATC
ATGGGCATCATCGAGGGTACGGCTTCGAAGAAGAAGGCCGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 315 Bases
Molecular Weight97567.84 Da
Coding Sequence complement(CP000697.1:2757904..2758218)
NCBI ReferenceABQ31695
NotesPFAM: chaperonin Cpn10

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 2 to 94 93 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACCR1

Accession Number

HSP60_0010

Added on

2012-02-02

Updated On

2014-01-20