Help  Custom Search
 
Chaperonin GroEL of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL

Synonymous Names

A5FYA5_ACICJ, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

Acry_1376

Gene Identifier

5159575

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAKLLLHNSEARRALARGVGRLAAAVEPTLGPKGMNAMIDRPIGTPMVTRDGVSIAVEIELPNRFENMGA QVVREVSMQTNELAGDGTTTAIVLANALVQAGVEASERGARAVDLIRGIDLAVERVASSLKEAARPASGN GMLAAVANIAATEPHLGALVAEAFARVGAEGVITTDFSVTTATTLEVVEGMSFDRGYISHHMVTDQEKME AVLERPLILMTDLKIRDPHALDAARALAADAHRPLLVIAEEVAPEVVVSLLGRDGPGRYLVVHPPEYGNW RKAMMEDIAIITGGRVIARDLGGRVEDVTAADLGAAERVRTSATHTAIIGGAGDPAAIAARRAQVQRMHD IAPPNIEQDKLRERLAKLSGGTAILYAGGATPVEQKRTIQLIEDSLAAVRAASEEGVVAGGGTALAQIGP VLDEVLAGVGGDVAEGVKLVRSILTRPLWRIVTNAGGDPDHVVAQVSAVNGGFGYNAAIGTFQNMYDAGI IDPVRVTCTALRNAASVAKLILTTETLVGDLGEDEEDPTASPARGGGAERLGRA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTAAGCTGCTTCTGCATAATTCCGAAGCCCGGCGTGCGCTGGCCCGCGGTGTGGGCCGGCTCGCGGCGGCCGTCGAGCCCACGCT
CGGGCCTAAAGGCATGAACGCGATGATCGACCGGCCGATCGGCACGCCGATGGTCACGCGCGATGGCGTCAGCATCGCGGTGGAGATCGA
GCTGCCGAACCGGTTCGAGAACATGGGCGCGCAGGTCGTCCGCGAGGTCTCGATGCAGACCAACGAACTCGCGGGCGACGGCACCACCAC
CGCGATCGTGCTCGCCAACGCGCTCGTCCAGGCCGGCGTCGAGGCCAGCGAGCGCGGCGCCCGCGCGGTCGATCTCATTCGCGGGATCGA
TCTCGCGGTCGAGCGCGTGGCATCGTCCCTCAAGGAAGCGGCCCGGCCGGCTTCCGGCAACGGCATGCTCGCCGCGGTGGCCAACATCGC
CGCAACCGAGCCGCATCTCGGCGCGCTGGTCGCCGAGGCCTTCGCGCGCGTCGGCGCCGAGGGCGTGATCACTACCGACTTCAGCGTGAC
CACCGCAACGACGCTCGAGGTCGTCGAAGGCATGTCCTTCGATCGCGGCTATATCTCGCATCACATGGTGACCGATCAGGAGAAGATGGA
AGCCGTGCTCGAACGGCCGCTGATCCTGATGACGGATCTCAAGATCCGCGATCCCCATGCGCTCGATGCGGCGCGCGCGCTCGCCGCCGA
CGCCCACCGCCCGCTTCTCGTGATCGCCGAGGAGGTGGCGCCGGAGGTCGTCGTCAGCCTGCTCGGGCGCGACGGGCCGGGCCGCTACCT
CGTCGTGCATCCGCCCGAATATGGCAACTGGCGCAAGGCGATGATGGAGGATATCGCCATCATCACCGGCGGCCGCGTCATCGCCCGCGA
TCTTGGCGGCCGGGTCGAGGACGTCACGGCGGCCGATCTCGGCGCCGCCGAGCGGGTGCGCACCAGTGCGACGCACACCGCGATCATCGG
CGGCGCCGGCGATCCGGCGGCGATCGCCGCGCGCCGGGCGCAGGTGCAGCGGATGCACGATATCGCCCCGCCCAATATCGAGCAGGACAA
GCTGCGCGAGCGCCTCGCGAAGCTTTCCGGCGGTACCGCCATACTTTATGCCGGCGGAGCGACGCCGGTCGAGCAGAAGCGCACCATCCA
GCTGATCGAGGATTCGCTCGCCGCCGTGCGCGCCGCGAGCGAGGAGGGGGTGGTTGCCGGCGGCGGCACCGCACTGGCGCAGATCGGCCC
GGTGCTCGACGAGGTTCTGGCCGGCGTCGGCGGCGATGTCGCGGAAGGGGTGAAGCTCGTCCGCTCCATCCTCACCCGCCCGCTCTGGCG
CATCGTGACCAATGCCGGCGGCGACCCCGACCACGTGGTCGCTCAGGTCTCGGCGGTGAATGGCGGTTTCGGCTACAATGCCGCCATCGG
CACGTTCCAGAACATGTACGATGCCGGCATCATCGATCCCGTCCGCGTCACCTGCACGGCGCTGCGCAACGCCGCCTCGGTCGCCAAGCT
GATCCTGACCACGGAAACGCTGGTGGGCGATCTGGGTGAGGACGAGGAAGACCCGACCGCGTCTCCCGCCCGCGGCGGCGGCGCCGAGCG
TCTCGGCCGCGCATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine25516 %
Guanine57035 %
Thyamine23615 %
Cytosine57436 %
A+T49131 %
G+C114470 %

Total Bases :   1635 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG14523
GCGCGC20523
CACCACCAC26033
CGCGCG33023
GCGCGC46923
CGCGCGCG49124
GCGCGCGCGC69925
GTCGTCGTC76533
CGCGCG101623
GCGCGC119623
CGGCGGCGG122633
GCGGCGGCGGCG160034

Microsatellite Map

ATGGCTAAGCTGCTTCTGCATAATTCCGAAGCCCGGCGTGCGCTGGCCCGCGGTGTGGGCCGGCTCGCGGCGGCCGTCGAGCCCACGCTC
GGGCCTAAAGGCATGAACGCGATGATCGACCGGCCGATCGGCACGCCGATGGTCACGCGCGATGGCGTCAGCATCGCGGTGGAGATCGAG
CTGCCGAACCGGTTCGAGAACATGGGCGCGCAGGTCGTCCGCGAGGTCTCGATGCAGACCAACGAACTCGCGGGCGACGGCACCACCACC
GCGATCGTGCTCGCCAACGCGCTCGTCCAGGCCGGCGTCGAGGCCAGCGAGCGCGGCGCCCGCGCGGTCGATCTCATTCGCGGGATCGAT
CTCGCGGTCGAGCGCGTGGCATCGTCCCTCAAGGAAGCGGCCCGGCCGGCTTCCGGCAACGGCATGCTCGCCGCGGTGGCCAACATCGCC
GCAACCGAGCCGCATCTCGGCGCGCTGGTCGCCGAGGCCTTCGCGCGCGTCGGCGCCGAGGGCGTGATCACTACCGACTTCAGCGTGACC
ACCGCAACGACGCTCGAGGTCGTCGAAGGCATGTCCTTCGATCGCGGCTATATCTCGCATCACATGGTGACCGATCAGGAGAAGATGGAA
GCCGTGCTCGAACGGCCGCTGATCCTGATGACGGATCTCAAGATCCGCGATCCCCATGCGCTCGATGCGGCGCGCGCGCTCGCCGCCGAC
GCCCACCGCCCGCTTCTCGTGATCGCCGAGGAGGTGGCGCCGGAGGTCGTCGTCAGCCTGCTCGGGCGCGACGGGCCGGGCCGCTACCTC
GTCGTGCATCCGCCCGAATATGGCAACTGGCGCAAGGCGATGATGGAGGATATCGCCATCATCACCGGCGGCCGCGTCATCGCCCGCGAT
CTTGGCGGCCGGGTCGAGGACGTCACGGCGGCCGATCTCGGCGCCGCCGAGCGGGTGCGCACCAGTGCGACGCACACCGCGATCATCGGC
GGCGCCGGCGATCCGGCGGCGATCGCCGCGCGCCGGGCGCAGGTGCAGCGGATGCACGATATCGCCCCGCCCAATATCGAGCAGGACAAG
CTGCGCGAGCGCCTCGCGAAGCTTTCCGGCGGTACCGCCATACTTTATGCCGGCGGAGCGACGCCGGTCGAGCAGAAGCGCACCATCCAG
CTGATCGAGGATTCGCTCGCCGCCGTGCGCGCCGCGAGCGAGGAGGGGGTGGTTGCCGGCGGCGGCACCGCACTGGCGCAGATCGGCCCG
GTGCTCGACGAGGTTCTGGCCGGCGTCGGCGGCGATGTCGCGGAAGGGGTGAAGCTCGTCCGCTCCATCCTCACCCGCCCGCTCTGGCGC
ATCGTGACCAATGCCGGCGGCGACCCCGACCACGTGGTCGCTCAGGTCTCGGCGGTGAATGGCGGTTTCGGCTACAATGCCGCCATCGGC
ACGTTCCAGAACATGTACGATGCCGGCATCATCGATCCCGTCCGCGTCACCTGCACGGCGCTGCGCAACGCCGCCTCGGTCGCCAAGCTG
ATCCTGACCACGGAAACGCTGGTGGGCGATCTGGGTGAGGACGAGGAAGACCCGACCGCGTCTCCCGCCCGCGGCGGCGGCGCCGAGCGT
CTCGGCCGCGCATGA

Gene Information
Molecule Type genomic DNA
Bases 1635 Bases
Molecular Weight505236.81 Da
Coding Sequence complement(CP000697.1:1532301..1533935)
NCBI ReferenceABQ30587
NotesPFAM: chaperonin Cpn60/TCP-1

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 28 to 520 493 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACCR2

Accession Number

HSP60_0009

Added on

2012-02-02

Updated On

2014-01-20