Help  Custom Search
 
Chaperonin GroEL of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL

Synonymous Names

CH60_ACICJ, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

Acry_2503

Gene Identifier

5161495

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAAKDVRFSADARERLIRGVDLLANAVKVTLGPKGRNVVIEKSFGSPRITKDGVTVAKEIELADKFENMG AQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDKAVNAIVDELKKRTKKITT PSETAQVGTISANGEAEIGKMISEAMQKVGNEGVITVEEAKGIQTELDVVEGMQFDRGYVSPYFITNPEK MVADLDNPYILIHEKKLSGLQPMLPLLESIVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG FGDRRKAMLEDIAILTGGQVISEDLGIKLETVTLNMLGRAKKVLIEKENTTIVEGAGKKADITGRCNQIR AQIEETTSDYDREKLQERLAKLAGGVAVIRVGGASETEVKERKDRVDDALHATRAAVEEGIVPGGGVALA RASLAINKLKADNDDQRFGIDIIRKAVLAPMRQIAENAGEDGAVISGKVLDNDDYSFGFDAQSGEFKDMV KAGIIDPTKVVRTALQDAASVAGLLITTEAMVAERPEKKAPAGGDAGMGGMGGMGGMDF

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTGCTAAAGACGTCCGCTTCTCGGCCGACGCCCGCGAACGCCTCATCCGCGGTGTCGACCTGCTCGCCAACGCGGTGAAGGTCAC
CCTCGGCCCCAAGGGCCGCAACGTCGTCATCGAGAAGAGCTTCGGTTCGCCCCGCATCACCAAGGACGGCGTGACGGTCGCGAAGGAAAT
CGAACTCGCCGACAAGTTCGAGAACATGGGCGCGCAGATGGTGCGCGAAGTGGCCTCGAAGACCAACGACCTCGCCGGTGACGGCACCAC
CACCGCGACCGTCCTCGCCCAGGCGATCGTCCGCGAGGGTGCGAAGGCGGTTGCCGCCGGCATGAACCCGATGGATCTGAAGCGCGGCAT
CGACAAGGCGGTCAACGCCATCGTCGACGAGCTGAAGAAGCGCACCAAGAAGATCACGACCCCGAGCGAAACCGCCCAGGTCGGCACCAT
CTCCGCCAACGGCGAGGCCGAGATCGGCAAGATGATCTCCGAGGCGATGCAGAAGGTCGGCAACGAGGGCGTCATCACGGTCGAGGAAGC
CAAGGGCATCCAGACCGAGCTCGACGTCGTCGAGGGCATGCAGTTCGACCGCGGCTACGTCTCGCCCTACTTCATCACCAACCCGGAGAA
GATGGTCGCGGATCTCGACAATCCGTACATCCTGATCCACGAGAAGAAGCTCTCCGGCCTGCAGCCGATGCTGCCGCTGCTCGAAAGCAT
CGTCCAGTCCGGCAAGCCGCTGCTGATCATCGCCGAGGACGTCGAGGGCGAGGCGCTGGCCACCCTGGTCGTCAACAAGCTGCGTGGCGG
CCTCAAGATCGCCGCCGTCAAGGCGCCCGGCTTCGGTGACCGCCGCAAGGCCATGCTGGAAGACATCGCGATCCTCACCGGCGGCCAGGT
CATCAGCGAAGATCTCGGCATCAAGCTCGAGACCGTGACGCTGAACATGCTCGGCCGCGCGAAGAAGGTGCTGATCGAGAAGGAAAACAC
CACGATCGTCGAAGGTGCCGGCAAGAAGGCCGACATCACCGGCCGCTGCAACCAGATCCGCGCGCAGATCGAGGAGACCACCTCGGACTA
CGACCGCGAGAAGCTGCAGGAGCGCCTGGCGAAGCTGGCCGGCGGCGTTGCCGTCATCCGCGTCGGCGGCGCCTCGGAGACCGAGGTGAA
GGAGCGCAAGGACCGCGTGGACGACGCGCTGCACGCGACCCGCGCCGCCGTCGAGGAAGGCATCGTCCCGGGTGGCGGCGTGGCCCTCGC
CCGCGCCTCGCTCGCGATCAACAAGCTCAAGGCCGATAACGACGACCAGCGCTTCGGCATCGACATCATCCGCAAGGCGGTGCTCGCGCC
GATGCGCCAGATCGCCGAGAACGCCGGCGAAGACGGCGCCGTGATCTCCGGCAAGGTGCTCGACAACGACGACTACAGCTTCGGCTTCGA
TGCCCAGTCCGGCGAGTTCAAGGACATGGTCAAGGCCGGCATCATCGACCCGACCAAGGTCGTCCGCACCGCGCTGCAGGACGCCGCCTC
GGTCGCCGGTCTGCTCATCACGACCGAAGCGATGGTCGCCGAGCGTCCGGAAAAGAAGGCCCCCGCCGGTGGCGACGCCGGAATGGGCGG
CATGGGCGGCATGGGCGGCATGGATTTCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine34421 %
Guanine53833 %
Thyamine21413 %
Cytosine55434 %
A+T55834 %
G+C109267 %

Total Bases :   1650 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC20823
CACCACCAC26333
CGCGCG95423
CGCGCG104723
ATGGGCGGCATGGGCGGCATGGGCGGC161193

Microsatellite Map

ATGGCTGCTAAAGACGTCCGCTTCTCGGCCGACGCCCGCGAACGCCTCATCCGCGGTGTCGACCTGCTCGCCAACGCGGTGAAGGTCACC
CTCGGCCCCAAGGGCCGCAACGTCGTCATCGAGAAGAGCTTCGGTTCGCCCCGCATCACCAAGGACGGCGTGACGGTCGCGAAGGAAATC
GAACTCGCCGACAAGTTCGAGAACATGGGCGCGCAGATGGTGCGCGAAGTGGCCTCGAAGACCAACGACCTCGCCGGTGACGGCACCACC
ACCGCGACCGTCCTCGCCCAGGCGATCGTCCGCGAGGGTGCGAAGGCGGTTGCCGCCGGCATGAACCCGATGGATCTGAAGCGCGGCATC
GACAAGGCGGTCAACGCCATCGTCGACGAGCTGAAGAAGCGCACCAAGAAGATCACGACCCCGAGCGAAACCGCCCAGGTCGGCACCATC
TCCGCCAACGGCGAGGCCGAGATCGGCAAGATGATCTCCGAGGCGATGCAGAAGGTCGGCAACGAGGGCGTCATCACGGTCGAGGAAGCC
AAGGGCATCCAGACCGAGCTCGACGTCGTCGAGGGCATGCAGTTCGACCGCGGCTACGTCTCGCCCTACTTCATCACCAACCCGGAGAAG
ATGGTCGCGGATCTCGACAATCCGTACATCCTGATCCACGAGAAGAAGCTCTCCGGCCTGCAGCCGATGCTGCCGCTGCTCGAAAGCATC
GTCCAGTCCGGCAAGCCGCTGCTGATCATCGCCGAGGACGTCGAGGGCGAGGCGCTGGCCACCCTGGTCGTCAACAAGCTGCGTGGCGGC
CTCAAGATCGCCGCCGTCAAGGCGCCCGGCTTCGGTGACCGCCGCAAGGCCATGCTGGAAGACATCGCGATCCTCACCGGCGGCCAGGTC
ATCAGCGAAGATCTCGGCATCAAGCTCGAGACCGTGACGCTGAACATGCTCGGCCGCGCGAAGAAGGTGCTGATCGAGAAGGAAAACACC
ACGATCGTCGAAGGTGCCGGCAAGAAGGCCGACATCACCGGCCGCTGCAACCAGATCCGCGCGCAGATCGAGGAGACCACCTCGGACTAC
GACCGCGAGAAGCTGCAGGAGCGCCTGGCGAAGCTGGCCGGCGGCGTTGCCGTCATCCGCGTCGGCGGCGCCTCGGAGACCGAGGTGAAG
GAGCGCAAGGACCGCGTGGACGACGCGCTGCACGCGACCCGCGCCGCCGTCGAGGAAGGCATCGTCCCGGGTGGCGGCGTGGCCCTCGCC
CGCGCCTCGCTCGCGATCAACAAGCTCAAGGCCGATAACGACGACCAGCGCTTCGGCATCGACATCATCCGCAAGGCGGTGCTCGCGCCG
ATGCGCCAGATCGCCGAGAACGCCGGCGAAGACGGCGCCGTGATCTCCGGCAAGGTGCTCGACAACGACGACTACAGCTTCGGCTTCGAT
GCCCAGTCCGGCGAGTTCAAGGACATGGTCAAGGCCGGCATCATCGACCCGACCAAGGTCGTCCGCACCGCGCTGCAGGACGCCGCCTCG
GTCGCCGGTCTGCTCATCACGACCGAAGCGATGGTCGCCGAGCGTCCGGAAAAGAAGGCCCCCGCCGGTGGCGACGCCGGAATGGGCGGC
ATGGGCGGCATGGGCGGCATGGATTTCTGA

Gene Information
Molecule Type genomic DNA
Bases 1650 Bases
Molecular Weight510101.78 Da
Coding Sequence complement(CP000697.1:2756210..2757859)
NCBI ReferenceABQ31694
NotesTIGRFAM: chaperonin GroEL; PFAM: chaperonin

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 4 to 524 521 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACCR1

Accession Number

HSP60_0008

Added on

2012-02-02

Updated On

2014-01-20