Help  Custom Search
 
chaperonin GroES. of Acholeplasma laidlawii str. PG-8A

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin GroES.

Synonymous Names

A9NHL7_ACHLI, Cpn10, 10 kDa protein.

Gene names

Gene Name

groES

Gene Locus Tag

ACL_1248

Gene Identifier

5804463

Taxon Information

Organism

Acholeplasma laidlawii str. PG-8A

Organism ID

441768 [NCBI] [UNIPROT]

Lineage

Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Acholeplasma; Acholeplasma laidlawii PG-8A

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MIKPLEDYVVLSVKKEEKTTASGIILATEDKDKPAMGKVISIGPKVENIKVNDEVIYQSYAGTKVKLKEV EYLLVQSKNILAIIEE

FASTA Format Composition Secondary Structure

Nucleotide
 GTGATTAAGCCATTAGAAGACTATGTTGTTCTATCAGTTAAAAAGGAAGAAAAAACTACAGCAAGTGGTATTATCCTAGCAACTGAAGA
CAAAGACAAACCAGCTATGGGTAAAGTAATTTCAATAGGACCAAAAGTTGAAAATATTAAGGTAAATGATGAGGTTATTTATCAATCTTA
TGCTGGAACTAAAGTCAAACTAAAAGAGGTTGAATATTTACTAGTTCAATCTAAAAATATTCTCGCAATCATAGAAGAATAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine11043 %
Guanine4719 %
Thyamine7128 %
Cytosine3313 %
A+T18170 %
G+C8031 %

Total Bases :   261 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA4923

Microsatellite Map

GTGATTAAGCCATTAGAAGACTATGTTGTTCTATCAGTTAAAAAGGAAGAAAAAACTACAGCAAGTGGTATTATCCTAGCAACTGAAGAC
AAAGACAAACCAGCTATGGGTAAAGTAATTTCAATAGGACCAAAAGTTGAAAATATTAAGGTAAATGATGAGGTTATTTATCAATCTTAT
GCTGGAACTAAAGTCAAACTAAAAGAGGTTGAATATTTACTAGTTCAATCTAAAAATATTCTCGCAATCATAGAAGAATAG

Gene Information
Molecule Type genomic DNA
Bases 261 Bases
Molecular Weight81005.15 Da
Coding Sequence complement(CP000896.1:1299253..1299513)
NCBI ReferenceABX81847
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 1 to 84 84 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACLA1

Accession Number

HSP60_0007

Added on

2012-02-02

Updated On

2014-01-20