Help  Custom Search
 
Chaperonin GroEL. of Acholeplasma laidlawii str. PG-8A

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL.

Synonymous Names

CH60_ACHLI, Hsp60, Protein Cpn60, groEL protein.

Gene names

Gene Name

groEL

Gene Locus Tag

ACL_1247

Gene Identifier

5804462

Taxon Information

Organism

Acholeplasma laidlawii str. PG-8A

Organism ID

441768 [NCBI] [UNIPROT]

Lineage

Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Acholeplasma; Acholeplasma laidlawii PG-8A

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MSKEIRYGKDAKQSLLKGVDLLANTVKITLGPKGRNVVLDKGYGSPLITNDGVSIAKEIELKDPYENMGA KLLYEVASKTNDVAGDGTTTATLLAQSIIHKGFKAVDNGANPVLVREGILRAGKEVSQKLLEKSRPVETS EDIENVASISASSREIGKIIAEAMDKVSKNGVISVDESKGFETELEVVEGMQYDKGYISPYFVSDRETMT VELENPHVLVTDQKISTIQDILPILEQVVKANKPLLIIADDIENEVTSTLILNKLRGTFNVVATKAPGFG DNQKDMLNDIAILTGATFYAKDLQMKLQEIKLEDLGLVQKAVVKKDTTTLIGGHGTKDAIDKRILEIEAQ INSSTSDYDKKRLQERLAKLAGGVAIIKVGAATEAELKEKKLRIEDALNATKAAILEGIVAGGGSVLVDI QTELKETLKDSHIDIYKGILAVLDSLSEPLYQIAENAGFDGQDILTEQRKQNKNYGFDAKEGKWVNMLKE GIIDPTKVTRNAILNASSIGALMITSEAAVVEIKDKDQNIPTQPMY

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGTAAAGAAATTCGTTATGGTAAAGATGCTAAACAATCTTTACTAAAAGGGGTAGATTTACTTGCTAATACAGTAAAAATCACCCT
TGGGCCAAAAGGAAGAAATGTAGTCTTGGACAAAGGATACGGTTCTCCACTGATTACAAATGATGGTGTATCCATTGCAAAAGAGATTGA
ATTAAAAGATCCATATGAAAATATGGGAGCAAAATTATTATATGAAGTTGCATCTAAAACAAATGATGTTGCTGGTGATGGTACAACAAC
TGCAACACTACTTGCACAATCCATTATCCATAAGGGATTTAAAGCTGTGGATAATGGTGCAAATCCAGTCTTAGTTAGAGAAGGTATTTT
ACGTGCTGGTAAAGAAGTTTCACAAAAGTTATTAGAAAAATCTAGACCGGTTGAAACTAGTGAAGATATAGAAAATGTAGCAAGCATTAG
TGCATCCTCTAGAGAAATCGGTAAAATAATTGCCGAAGCGATGGATAAGGTTTCAAAAAATGGTGTGATTTCAGTTGATGAGTCTAAAGG
TTTTGAAACAGAACTGGAAGTTGTTGAAGGTATGCAATATGATAAGGGGTATATATCACCTTACTTTGTAAGTGATCGAGAAACAATGAC
AGTTGAATTAGAAAATCCACATGTACTTGTAACTGATCAAAAGATATCTACAATTCAAGATATCTTACCGATATTAGAGCAAGTTGTTAA
AGCAAATAAGCCACTATTAATTATCGCTGATGATATAGAAAATGAAGTGACATCTACACTGATTCTAAACAAACTTAGAGGTACGTTTAA
TGTCGTTGCAACCAAAGCTCCTGGCTTTGGTGATAACCAAAAAGACATGTTAAATGATATTGCAATATTAACTGGTGCAACCTTCTATGC
AAAAGATTTACAGATGAAGCTTCAAGAAATTAAATTAGAAGATCTTGGACTGGTCCAAAAAGCTGTTGTTAAAAAAGATACAACAACACT
TATCGGTGGTCATGGCACTAAAGATGCTATTGACAAGCGTATTTTGGAAATTGAAGCACAAATTAATTCATCTACATCAGATTATGATAA
AAAACGCCTACAAGAAAGACTTGCAAAACTTGCTGGAGGTGTTGCAATCATCAAAGTAGGTGCAGCTACTGAAGCAGAATTAAAAGAAAA
GAAATTAAGAATAGAAGATGCGCTTAATGCAACAAAGGCTGCAATTTTAGAAGGTATTGTTGCTGGTGGTGGTTCCGTTTTAGTAGATAT
ACAAACTGAACTGAAAGAAACACTTAAAGATAGCCATATAGATATATATAAAGGCATACTTGCTGTCTTAGATTCATTATCGGAACCACT
TTATCAAATAGCTGAAAATGCTGGTTTTGATGGCCAAGATATATTAACAGAACAAAGAAAACAAAATAAAAACTATGGGTTTGATGCTAA
AGAAGGTAAGTGGGTTAATATGCTGAAAGAAGGTATCATTGACCCAACTAAAGTTACAAGAAATGCAATTCTTAATGCATCAAGTATTGG
AGCATTAATGATCACTTCTGAAGCAGCAGTTGTGGAAATTAAAGATAAAGACCAAAATATACCTACACAACCAATGTATTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine62439 %
Guanine31820 %
Thyamine44328 %
Cytosine22615 %
A+T106767 %
G+C54434 %

Total Bases :   1611 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA50323
TATATA58823
AAAAAA96923
ACAACAACA97833
AAAAAA107723
TGGTGGTGG123233
ATATATAT130024
ATATAT138723

Microsatellite Map

ATGAGTAAAGAAATTCGTTATGGTAAAGATGCTAAACAATCTTTACTAAAAGGGGTAGATTTACTTGCTAATACAGTAAAAATCACCCTT
GGGCCAAAAGGAAGAAATGTAGTCTTGGACAAAGGATACGGTTCTCCACTGATTACAAATGATGGTGTATCCATTGCAAAAGAGATTGAA
TTAAAAGATCCATATGAAAATATGGGAGCAAAATTATTATATGAAGTTGCATCTAAAACAAATGATGTTGCTGGTGATGGTACAACAACT
GCAACACTACTTGCACAATCCATTATCCATAAGGGATTTAAAGCTGTGGATAATGGTGCAAATCCAGTCTTAGTTAGAGAAGGTATTTTA
CGTGCTGGTAAAGAAGTTTCACAAAAGTTATTAGAAAAATCTAGACCGGTTGAAACTAGTGAAGATATAGAAAATGTAGCAAGCATTAGT
GCATCCTCTAGAGAAATCGGTAAAATAATTGCCGAAGCGATGGATAAGGTTTCAAAAAATGGTGTGATTTCAGTTGATGAGTCTAAAGGT
TTTGAAACAGAACTGGAAGTTGTTGAAGGTATGCAATATGATAAGGGGTATATATCACCTTACTTTGTAAGTGATCGAGAAACAATGACA
GTTGAATTAGAAAATCCACATGTACTTGTAACTGATCAAAAGATATCTACAATTCAAGATATCTTACCGATATTAGAGCAAGTTGTTAAA
GCAAATAAGCCACTATTAATTATCGCTGATGATATAGAAAATGAAGTGACATCTACACTGATTCTAAACAAACTTAGAGGTACGTTTAAT
GTCGTTGCAACCAAAGCTCCTGGCTTTGGTGATAACCAAAAAGACATGTTAAATGATATTGCAATATTAACTGGTGCAACCTTCTATGCA
AAAGATTTACAGATGAAGCTTCAAGAAATTAAATTAGAAGATCTTGGACTGGTCCAAAAAGCTGTTGTTAAAAAAGATACAACAACACTT
ATCGGTGGTCATGGCACTAAAGATGCTATTGACAAGCGTATTTTGGAAATTGAAGCACAAATTAATTCATCTACATCAGATTATGATAAA
AAACGCCTACAAGAAAGACTTGCAAAACTTGCTGGAGGTGTTGCAATCATCAAAGTAGGTGCAGCTACTGAAGCAGAATTAAAAGAAAAG
AAATTAAGAATAGAAGATGCGCTTAATGCAACAAAGGCTGCAATTTTAGAAGGTATTGTTGCTGGTGGTGGTTCCGTTTTAGTAGATATA
CAAACTGAACTGAAAGAAACACTTAAAGATAGCCATATAGATATATATAAAGGCATACTTGCTGTCTTAGATTCATTATCGGAACCACTT
TATCAAATAGCTGAAAATGCTGGTTTTGATGGCCAAGATATATTAACAGAACAAAGAAAACAAAATAAAAACTATGGGTTTGATGCTAAA
GAAGGTAAGTGGGTTAATATGCTGAAAGAAGGTATCATTGACCCAACTAAAGTTACAAGAAATGCAATTCTTAATGCATCAAGTATTGGA
GCATTAATGATCACTTCTGAAGCAGCAGTTGTGGAAATTAAAGATAAAGACCAAAATATACCTACACAACCAATGTATTAA

Gene Information
Molecule Type genomic DNA
Bases 1611 Bases
Molecular Weight500185.14 Da
Coding Sequence complement(CP000896.1:1297617..1299227)
NCBI ReferenceABX81846
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 3 to 522 520 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACLA1

Accession Number

HSP60_0006

Added on

2012-02-02

Updated On

2014-01-20