Help  Custom Search
 
chaperonin GroES. of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperonin GroES.

Synonymous Names

A8ZNW6_ACAM1, Cpn10, 10 kDa protein.

Gene names

Gene Name

groS

Gene Locus Tag

AM1_D0207

Gene Identifier

5686626

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MSTLTLNVSTVSPLGDRVFLKVNRAEEKTAGGILMPDTAQEKSQVGKVVSVGPGLRSGNGSYAPIDVQVG DQVLYAKYSGTDIKLGNEDYVLTKAQDILAIVT

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCCACTCTAACCCTCAACGTTTCTACTGTTAGCCCTCTCGGCGACCGTGTCTTTCTGAAGGTAAATAGGGCTGAAGAAAAAACCGC
AGGTGGCATCTTAATGCCCGATACAGCTCAAGAGAAATCTCAAGTGGGAAAGGTGGTTAGTGTTGGGCCTGGTTTGAGGTCTGGGAATGG
CTCCTATGCCCCCATCGACGTTCAAGTCGGCGATCAGGTGCTATATGCCAAATACAGTGGAACGGATATCAAACTGGGTAATGAAGATTA
TGTGCTGACCAAAGCTCAAGATATTCTCGCGATTGTCACATAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine8427 %
Guanine8026 %
Thyamine7926 %
Cytosine6923 %
A+T16353 %
G+C14948 %

Total Bases :   312 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA7923

Microsatellite Map

ATGTCCACTCTAACCCTCAACGTTTCTACTGTTAGCCCTCTCGGCGACCGTGTCTTTCTGAAGGTAAATAGGGCTGAAGAAAAAACCGCA
GGTGGCATCTTAATGCCCGATACAGCTCAAGAGAAATCTCAAGTGGGAAAGGTGGTTAGTGTTGGGCCTGGTTTGAGGTCTGGGAATGGC
TCCTATGCCCCCATCGACGTTCAAGTCGGCGATCAGGTGCTATATGCCAAATACAGTGGAACGGATATCAAACTGGGTAATGAAGATTAT
GTGCTGACCAAAGCTCAAGATATTCTCGCGATTGTCACATAG

Gene Information
Molecule Type genomic DNA
Bases 312 Bases
Molecular Weight96569.7 Da
Coding Sequence CP000841.1:171902..172213
NCBI ReferenceABW32702
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Cpn10 10 to 102 93 Chaperonin 10 Kd subunit (cpn10 or GroES) PF00166
Cd00320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroES_ACMA2

Accession Number

HSP60_0005

Added on

2012-02-02

Updated On

2014-01-20