Help  Custom Search
 
Chaperonin GroEL. of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL.

Synonymous Names

CH603_ACAM1, Hsp60, Protein Cpn60 3, groEL protein 3.

Gene names

Gene Name

groEL3

Gene Locus Tag

AM1_D0208

Gene Identifier

5686627

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MMAKSIQYDTAARHALEQGIDLLTEAVAVTLGPRGRNVVLEQKFGPPQIVNDGITIAKEIELDNPLANTG VALLRQVAAKTNDAAGDGTTTAVVLSHAMVKEGLRNIAAGANPMAIRRGIDQATQFLLDQIAEHALPVKD SNAISQVGTIAAGNDETVGQMIAAAMAKVGQQGVISLEEGQSMQTEVEVTEGMRFDKGYISPYFVTDAER MVTTLDDAYLLLTDKKITLVNALLPILENVTQTGKPLVIIAEDIEKEALATLVLNQLRGTVRVAGVKAPG FGDRRKDLLADIAVLTGGQVISEDTGLTLENATLEMMGRARQVVITKDHTTLISESNEAAVKARCEQIHR LIDETDSSFEKEKLHERLAQLSGGVAVIKVGAATETEMKDRKLKLEDAINATQAAVEEGIVPGGGTTLVH LAPQLEDWSAEHLVGDELIGAMILVRSLSAPLRQIVENAGLNGGVVVEQVKTLPFNTGYDALNNQYVDMF TAGIVDPAKVTSAGLRNAASIAGMVLTTECIIAEQSQATTKDLANAG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGATGGCTAAGTCAATTCAATACGATACAGCGGCTCGCCATGCCTTAGAGCAAGGGATCGATCTGCTGACTGAAGCAGTGGCAGTGAC
CTTAGGACCTAGAGGCCGCAATGTCGTCCTTGAGCAAAAATTTGGTCCCCCGCAAATTGTGAATGATGGCATCACCATTGCCAAGGAAAT
TGAACTAGACAACCCTTTAGCCAATACAGGCGTAGCCTTGTTGCGCCAAGTTGCAGCCAAAACCAATGATGCGGCAGGGGATGGCACCAC
CACAGCCGTTGTTTTAAGCCATGCAATGGTAAAGGAAGGGTTGCGCAATATCGCAGCGGGAGCCAATCCAATGGCAATACGACGGGGCAT
CGACCAGGCCACCCAATTTTTGTTGGATCAGATTGCTGAACATGCACTACCTGTGAAAGATTCCAATGCGATCTCACAGGTTGGGACCAT
TGCTGCGGGCAATGATGAAACTGTGGGGCAAATGATTGCTGCTGCCATGGCAAAGGTGGGTCAGCAAGGGGTGATTTCTTTGGAAGAAGG
CCAATCAATGCAGACCGAAGTCGAAGTCACGGAAGGGATGCGGTTTGACAAGGGGTATATTTCACCTTACTTCGTAACGGATGCCGAGCG
AATGGTGACGACTCTGGATGATGCCTACCTATTACTAACGGATAAAAAGATCACCTTAGTGAATGCCTTACTGCCCATTCTGGAGAACGT
TACACAAACGGGTAAACCTCTTGTGATAATTGCTGAAGATATTGAAAAAGAAGCCTTAGCAACCCTTGTCCTAAATCAATTACGAGGTAC
TGTCAGGGTGGCTGGGGTTAAGGCACCTGGATTTGGCGATCGCCGCAAGGATCTGTTAGCTGATATAGCAGTACTCACTGGAGGACAAGT
CATCAGCGAAGATACTGGGCTGACCTTAGAAAACGCCACCCTAGAAATGATGGGCCGTGCTCGCCAAGTGGTCATCACTAAGGACCATAC
CACCCTCATTTCGGAAAGCAATGAAGCTGCTGTCAAAGCGCGTTGTGAGCAAATTCATCGCCTGATAGATGAGACAGACTCATCCTTTGA
AAAGGAAAAACTGCATGAGCGTCTAGCTCAGCTTTCTGGTGGGGTAGCTGTAATCAAGGTTGGGGCCGCCACTGAAACGGAAATGAAGGA
CCGTAAGTTAAAACTAGAAGACGCGATTAACGCAACTCAAGCCGCTGTTGAGGAAGGCATTGTTCCAGGTGGTGGTACAACCCTCGTGCA
TCTTGCCCCTCAACTTGAGGACTGGTCTGCTGAACATTTGGTTGGTGATGAACTGATCGGAGCCATGATTCTAGTCCGTTCCCTCTCTGC
TCCATTGAGACAGATTGTGGAGAACGCGGGTCTGAATGGTGGGGTGGTTGTAGAGCAGGTTAAGACTTTACCGTTCAACACGGGCTATGA
TGCCTTGAACAACCAGTATGTGGATATGTTTACTGCCGGGATTGTCGATCCAGCTAAGGTGACTAGTGCTGGGTTGCGAAATGCCGCTTC
CATTGCGGGTATGGTTCTGACCACAGAGTGCATTATTGCGGAGCAATCTCAGGCCACAACAAAGGATTTAGCGAATGCTGGTTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine43928 %
Guanine44028 %
Thyamine37924 %
Cytosine35623 %
A+T81851 %
G+C79650 %

Total Bases :   1614 bases

Microsatellites
SequencePosition LengthRepeats
CACCACCAC26333
TGCTGCTGC48533
GGTGGTGGT123633
CTCTCT134123

Microsatellite Map

ATGATGGCTAAGTCAATTCAATACGATACAGCGGCTCGCCATGCCTTAGAGCAAGGGATCGATCTGCTGACTGAAGCAGTGGCAGTGACC
TTAGGACCTAGAGGCCGCAATGTCGTCCTTGAGCAAAAATTTGGTCCCCCGCAAATTGTGAATGATGGCATCACCATTGCCAAGGAAATT
GAACTAGACAACCCTTTAGCCAATACAGGCGTAGCCTTGTTGCGCCAAGTTGCAGCCAAAACCAATGATGCGGCAGGGGATGGCACCACC
ACAGCCGTTGTTTTAAGCCATGCAATGGTAAAGGAAGGGTTGCGCAATATCGCAGCGGGAGCCAATCCAATGGCAATACGACGGGGCATC
GACCAGGCCACCCAATTTTTGTTGGATCAGATTGCTGAACATGCACTACCTGTGAAAGATTCCAATGCGATCTCACAGGTTGGGACCATT
GCTGCGGGCAATGATGAAACTGTGGGGCAAATGATTGCTGCTGCCATGGCAAAGGTGGGTCAGCAAGGGGTGATTTCTTTGGAAGAAGGC
CAATCAATGCAGACCGAAGTCGAAGTCACGGAAGGGATGCGGTTTGACAAGGGGTATATTTCACCTTACTTCGTAACGGATGCCGAGCGA
ATGGTGACGACTCTGGATGATGCCTACCTATTACTAACGGATAAAAAGATCACCTTAGTGAATGCCTTACTGCCCATTCTGGAGAACGTT
ACACAAACGGGTAAACCTCTTGTGATAATTGCTGAAGATATTGAAAAAGAAGCCTTAGCAACCCTTGTCCTAAATCAATTACGAGGTACT
GTCAGGGTGGCTGGGGTTAAGGCACCTGGATTTGGCGATCGCCGCAAGGATCTGTTAGCTGATATAGCAGTACTCACTGGAGGACAAGTC
ATCAGCGAAGATACTGGGCTGACCTTAGAAAACGCCACCCTAGAAATGATGGGCCGTGCTCGCCAAGTGGTCATCACTAAGGACCATACC
ACCCTCATTTCGGAAAGCAATGAAGCTGCTGTCAAAGCGCGTTGTGAGCAAATTCATCGCCTGATAGATGAGACAGACTCATCCTTTGAA
AAGGAAAAACTGCATGAGCGTCTAGCTCAGCTTTCTGGTGGGGTAGCTGTAATCAAGGTTGGGGCCGCCACTGAAACGGAAATGAAGGAC
CGTAAGTTAAAACTAGAAGACGCGATTAACGCAACTCAAGCCGCTGTTGAGGAAGGCATTGTTCCAGGTGGTGGTACAACCCTCGTGCAT
CTTGCCCCTCAACTTGAGGACTGGTCTGCTGAACATTTGGTTGGTGATGAACTGATCGGAGCCATGATTCTAGTCCGTTCCCTCTCTGCT
CCATTGAGACAGATTGTGGAGAACGCGGGTCTGAATGGTGGGGTGGTTGTAGAGCAGGTTAAGACTTTACCGTTCAACACGGGCTATGAT
GCCTTGAACAACCAGTATGTGGATATGTTTACTGCCGGGATTGTCGATCCAGCTAAGGTGACTAGTGCTGGGTTGCGAAATGCCGCTTCC
ATTGCGGGTATGGTTCTGACCACAGAGTGCATTATTGCGGAGCAATCTCAGGCCACAACAAAGGATTTAGCGAATGCTGGTTGA

Gene Information
Molecule Type genomic DNA
Bases 1614 Bases
Molecular Weight500529.51 Da
Coding Sequence CP000841.1:172239..173852
NCBI ReferenceABW32703
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 4 to 524 521 GroEL/cpn60 chaperonin domain PF00118
Cd03344

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACMA3

Accession Number

HSP60_0003

Added on

2012-02-02

Updated On

2014-01-20