Help  Custom Search
 
Chaperonin GroEL. of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonin GroEL.

Synonymous Names

CH602_ACAM1, Hsp60, Protein Cpn60 2, groEL protein 2.

Gene names

Gene Name

groEL2

Gene Locus Tag

AM1_4411

Gene Identifier

5683213

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp60 Protein family

Protein Type

Group I Chaperonin
(Bacterial Homolog)

SEQUENCE INFORMATION

Sequence
MAKRIIYNENARRALEKGMDILCESVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDNIENTGV ALIRQAASKTNDAAGDGTTTATVLAHAMVKEGMRNVVAGANAISLKRGIEKAAGFLVEKIAENARSVEDS TAIAQVGTISAGNDDEVGQMIANAMDKVGKEGVISLEEGKSMTTELEVTEGMRFEKGYISPYFATDTERM EAVLDEPYILLTDKKITLVQDLVPVLEQAARAGKPLLVIAEDIEKEALATLVVNRLRGVLNVAAVKAPGF GDRRKAMLEDIAVLTGGQVITEDAGLKLETAKLEMMGQARRITITKDTTTLVAEGNEADVQARCEQIRRQ MDETESSYDKEKLQERLAKLAGGVAVIKVGAATETEMKDRKLRLEDAINSTKAAVEEGIVPGGGTTLAHL GPQLASWAADNLTGEELIGATIVERALTAPLKRIAENAGQNGAVIAERVREKEFNVGFDASVNEFTDMFA AGIVDPAKVTRSALQNAASIAGMVLTTECIISDKPEPKENAPTGAGMGGDFDY

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTAAACGCATTATTTATAACGAGAATGCTCGTCGCGCCCTTGAGAAAGGGATGGATATTCTATGTGAATCTGTTGCGGTGACATT
AGGCCCTAAAGGTCGCAATGTTGTTCTAGAAAAGAAATTTGGTGCCCCTCAGATTGTCAATGATGGTGTCACCATTGCTAAGGAAATTGA
ACTAGAAGACAACATTGAGAACACAGGGGTTGCCCTGATTCGTCAAGCGGCTTCCAAAACGAATGATGCCGCAGGAGATGGCACCACAAC
AGCTACCGTCCTTGCCCATGCCATGGTCAAAGAAGGGATGCGCAACGTAGTTGCGGGTGCGAATGCAATTTCCCTCAAGCGTGGCATTGA
GAAAGCTGCTGGCTTTCTTGTAGAGAAAATCGCTGAGAATGCTCGCTCTGTTGAAGATTCCACCGCCATTGCTCAAGTGGGAACGATTTC
TGCAGGTAATGACGATGAAGTCGGCCAAATGATTGCCAATGCGATGGATAAGGTTGGCAAAGAAGGCGTTATTTCCCTTGAAGAAGGCAA
GTCCATGACCACCGAATTGGAGGTCACTGAAGGGATGCGCTTTGAGAAAGGCTATATTTCTCCTTATTTCGCGACTGACACAGAGCGGAT
GGAAGCTGTGCTAGACGAGCCCTACATCCTACTGACCGACAAGAAAATTACCCTCGTGCAAGATTTAGTGCCTGTACTCGAGCAGGCTGC
ACGGGCAGGTAAGCCCTTGTTGGTGATTGCTGAGGATATTGAGAAAGAAGCCTTAGCCACCCTCGTCGTCAACCGTTTACGGGGTGTGTT
GAATGTAGCTGCCGTGAAAGCACCTGGCTTCGGCGATCGTCGTAAAGCCATGCTGGAAGATATTGCAGTCTTGACTGGTGGTCAGGTGAT
TACTGAAGATGCAGGTCTCAAACTAGAGACTGCCAAGCTAGAAATGATGGGACAAGCTCGTCGCATCACCATCACGAAAGACACCACTAC
CCTTGTTGCCGAAGGCAATGAGGCCGACGTCCAAGCTCGCTGCGAGCAAATTCGTCGTCAAATGGATGAGACCGAGTCTTCCTACGATAA
AGAGAAGTTGCAAGAGCGCTTGGCTAAATTGGCCGGTGGTGTTGCGGTGATCAAAGTCGGTGCTGCCACTGAAACTGAGATGAAGGATCG
AAAGCTCCGCCTAGAAGATGCCATCAACTCCACTAAAGCGGCTGTTGAAGAAGGGATTGTTCCCGGTGGTGGAACCACCTTGGCTCATCT
TGGTCCTCAACTTGCAAGTTGGGCTGCGGATAACTTAACTGGCGAAGAGCTGATTGGTGCCACTATCGTTGAACGGGCCTTAACTGCACC
TCTAAAGCGCATTGCTGAGAATGCTGGCCAAAATGGTGCCGTTATCGCTGAACGCGTTCGTGAAAAAGAGTTCAATGTCGGTTTTGATGC
GTCAGTGAATGAGTTCACGGATATGTTTGCCGCTGGCATTGTCGATCCTGCAAAGGTGACTCGTTCTGCGCTGCAAAATGCCGCTTCTAT
TGCTGGTATGGTCCTCACCACTGAGTGCATTATTTCTGATAAGCCTGAGCCGAAGGAAAATGCTCCTACCGGTGCTGGCATGGGTGGAGA
CTTCGATTACTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine42426 %
Guanine44828 %
Thyamine39725 %
Cytosine36323 %
A+T82151 %
G+C81150 %

Total Bases :   1632 bases

Microsatellites
SequencePosition LengthRepeats
GTGTGT80223

Microsatellite Map

ATGGCTAAACGCATTATTTATAACGAGAATGCTCGTCGCGCCCTTGAGAAAGGGATGGATATTCTATGTGAATCTGTTGCGGTGACATTA
GGCCCTAAAGGTCGCAATGTTGTTCTAGAAAAGAAATTTGGTGCCCCTCAGATTGTCAATGATGGTGTCACCATTGCTAAGGAAATTGAA
CTAGAAGACAACATTGAGAACACAGGGGTTGCCCTGATTCGTCAAGCGGCTTCCAAAACGAATGATGCCGCAGGAGATGGCACCACAACA
GCTACCGTCCTTGCCCATGCCATGGTCAAAGAAGGGATGCGCAACGTAGTTGCGGGTGCGAATGCAATTTCCCTCAAGCGTGGCATTGAG
AAAGCTGCTGGCTTTCTTGTAGAGAAAATCGCTGAGAATGCTCGCTCTGTTGAAGATTCCACCGCCATTGCTCAAGTGGGAACGATTTCT
GCAGGTAATGACGATGAAGTCGGCCAAATGATTGCCAATGCGATGGATAAGGTTGGCAAAGAAGGCGTTATTTCCCTTGAAGAAGGCAAG
TCCATGACCACCGAATTGGAGGTCACTGAAGGGATGCGCTTTGAGAAAGGCTATATTTCTCCTTATTTCGCGACTGACACAGAGCGGATG
GAAGCTGTGCTAGACGAGCCCTACATCCTACTGACCGACAAGAAAATTACCCTCGTGCAAGATTTAGTGCCTGTACTCGAGCAGGCTGCA
CGGGCAGGTAAGCCCTTGTTGGTGATTGCTGAGGATATTGAGAAAGAAGCCTTAGCCACCCTCGTCGTCAACCGTTTACGGGGTGTGTTG
AATGTAGCTGCCGTGAAAGCACCTGGCTTCGGCGATCGTCGTAAAGCCATGCTGGAAGATATTGCAGTCTTGACTGGTGGTCAGGTGATT
ACTGAAGATGCAGGTCTCAAACTAGAGACTGCCAAGCTAGAAATGATGGGACAAGCTCGTCGCATCACCATCACGAAAGACACCACTACC
CTTGTTGCCGAAGGCAATGAGGCCGACGTCCAAGCTCGCTGCGAGCAAATTCGTCGTCAAATGGATGAGACCGAGTCTTCCTACGATAAA
GAGAAGTTGCAAGAGCGCTTGGCTAAATTGGCCGGTGGTGTTGCGGTGATCAAAGTCGGTGCTGCCACTGAAACTGAGATGAAGGATCGA
AAGCTCCGCCTAGAAGATGCCATCAACTCCACTAAAGCGGCTGTTGAAGAAGGGATTGTTCCCGGTGGTGGAACCACCTTGGCTCATCTT
GGTCCTCAACTTGCAAGTTGGGCTGCGGATAACTTAACTGGCGAAGAGCTGATTGGTGCCACTATCGTTGAACGGGCCTTAACTGCACCT
CTAAAGCGCATTGCTGAGAATGCTGGCCAAAATGGTGCCGTTATCGCTGAACGCGTTCGTGAAAAAGAGTTCAATGTCGGTTTTGATGCG
TCAGTGAATGAGTTCACGGATATGTTTGCCGCTGGCATTGTCGATCCTGCAAAGGTGACTCGTTCTGCGCTGCAAAATGCCGCTTCTATT
GCTGGTATGGTCCTCACCACTGAGTGCATTATTTCTGATAAGCCTGAGCCGAAGGAAAATGCTCCTACCGGTGCTGGCATGGGTGGAGAC
TTCGATTACTAG

Gene Information
Molecule Type genomic DNA
Bases 1632 Bases
Molecular Weight505964.9 Da
Coding Sequence complement(CP000828.1:4437180..4438811)
NCBI ReferenceABW29388
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
GroEL 3 to 523 521 GroEL/cpn60 chaperonin domain PF00118
Cd03344
Coiled coil 332 to 365 34 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GroEL_ACMA2

Accession Number

HSP60_0002

Added on

2012-02-02

Updated On

2014-01-20