Help  Custom Search
 
DnaJ homolog subfamily C member 27 isoform 1 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily C member 27 isoform 1

Synonymous Names

DJC27_HUMAN, Hsp40/J-protein, DnaJ homolog subfamily C member 27, Rab and DnaJ domain-containing protein, DNAJC27, RABJS, RBJ

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK

FASTA Format Composition Secondary Structure

Nucleotide
 GTCTCCCTCCCCCGGCTCCCCACGCTCCCAACCGCCCGCGCCTGCTGCCAGGCAGCGGCGGGGATGGCGAGCAGCGGAGGCGAGGCGGT
GACGAGAGCAGCGGCTCCGCCATTGGACGAGGAGGCCTGAGGGACGGGCCAGCGGTGCACAAGAAGAGACCGAGGCGGGTGGCCCCGAGA
GAGCCAGGGCCATGGAGGCCAACATGCCGAAGCGGAAGGAGCCCGGCAGGTCTCTCCGCATCAAAGTCATCTCCATGGGCAACGCCGAAG
TGGGGAAAAGCTGTATTATAAAGCGATACTGTGAGAAAAGATTCGTGTCTAAATACCTGGCAACAATTGGAATTGACTATGGAGTCACAA
AGGTACACGTCAGAGACAGAGAAATCAAAGTTAACATCTTTGATATGGCTGGACATCCCTTCTTCTATGAGGTTCGAAATGAGTTTTACA
AGGACACACAGGGTGTGATACTGGTCTATGATGTTGGGCAGAAAGACTCCTTTGACGCCCTTGATGCGTGGCTGGCAGAAATGAAGCAAG
AGCTTGGACCTCATGGAAACATGGAAAATATTATATTTGTAGTTTGTGCCAACAAGATTGATTGTACCAAACATCGCTGTGTAGATGAAA
GTGAAGGACGTCTTTGGGCTGAAAGCAAAGGGTTCCTGTACTTTGAAACTTCAGCACAAACTGGAGAAGGCATTAATGAGATGTTCCAGA
CCTTTTATATATCCATAGTTGATTTATGTGAAAATGGCGGGAAACGCCCTACCACCAATAGCAGTGCTAGTTTCACCAAAGAACAAGCAG
ATGCCATTCGCAGAATTCGAAATAGTAAAGACAGTTGGGACATGCTGGGAGTCAAACCTGGGGCCTCAAGGGATGAAGTCAATAAAGCGT
ATCGGAAACTTGCTGTGCTTCTTCACCCTGACAAATGTGTAGCACCTGGCAGTGAAGATGCCTTCAAAGCAGTTGTGAATGCTCGGACAG
CCCTCCTGAAAAACATCAAGTAGAAAGTACAGAAAAAAGCCACATGTGGGACTCAAATGCAAACAGACTTTCCCTAGAGGTGAAATAACC
AACGTGGAGTTTTCCTTCCCAGAATCTCACTGCTCTTTTCATTCATGTGTTGTCATTTGTATATCAGTAATTCAGGTACCCATTTCATAG
ACATTTTACTGAGAAATGACCTGCATTTGTATGAAGTGAACTGAGCGTCACACCCTGTACTTCATTTCATATTTCTAGATAATTCTGAAT
TTTTTTCTCATTCGTCAGCTCTGTAATTATAGTATCACTTAGACATTTCACTTGGGGAAATCCACAAGGTTCCTGGAGGAGGGAAGAGAG
GACAAGAGGACCCTTTCACTTTTTCTTTTTTACGGAATTCATCATCAGAGAAGAAAATAACAAAAATGGAAGCAAACAACATCAGAACCC
CTGTAAGTTTGGTGTGACCTTACAGACAAGTTGCTGCTTTTACAATGAGTTCCTTAGGTGGTATTTTAACCCATCGATCTATAATGATGA
CTCTTGGCAGCCCTTTGGGAGTTTGTAAAATGAGGTGATACAGTTCTGAATTGAGCATTCCTTTATGATATTCACTCTGTTCCTCTTCTG
CAGCCACCAGTGGGAGAGACAAGCCAGTCCTAAGAGAAAAGGTGGTGGCAGCCACAAATTCTAGGTACACTGGCTGCTGCCTATCCTGTC
CCTGGATCTGAGGCCTTTCCCTTGCCATAGAAATGGTTGCTGGTAGCAGTAGAGAGCACTGTGCACCTGGGAATGAGGAATCAGGCCCCA
AGACAGAAGTACTTGGAGGAGCCAGCTGCAGTAGTATCCGCCTGTAGTCCCAGCTACTCAGGAGGCTGAGACAGGAGGATTGCTTAAGCC
CAGGAGCTCAAGTCCCACCTGGGCAACATAGTAAGATCTTGTCTCTTAAAGAAAAAAAAAAAAGGTACTTAGAGGTCGCACTTAAAGATT
ATGCACATCAGCAGAGGAAAGGCCAGCCAAGCTTGGGGCAAGCTTGATGCAGTAGGAGAGACTCCTTATGAGGCTTAGCCCTTGTCTTAC
TGCCAGCCTTTGCCACAGGCAGGTGAGAAAGGCAGGGCCACTCCTCAGCAAAGTTGGCCTCTTCTACACTTCCTCACCAGTGTTGTTTCT
TCCTTTTTTCCCCTCTTCCCCTTCCCGTCTTGTGTTTTTTCTGAACCCCACATCTGCCATCATTTCTCTCCTCTAGAGTCCCTGGCTTCT
GGCCACTGCCTCCTCCCTCTTCTAAGCCTTGGCCTGAATCTGGTTGATCAGAGGCAAGTGTGGATCCTTTGGGTGGCAGTCAGGGGAGAT
CTCAGGGCCTCTGTTGGGAGGAATCTCTGTAATTCCTGCTTGGGCTCCAAATTTCTGAAGAGTAATATTTTTAAACTATAGCTTACAAAA
TACATTCTCTGACCACAGTCTCCTCCTTGATATACAAGGGATGGATGAAGTTCATGTATTAGGACTGGCACTCCTTACGGTGCTTATAGA
ACTAGTCTCACCACTTGACTCATTACGTCGTCATTCTTGTTACATCACTCATACTTTTAGCTGCAACCACACTAATTCACATTTTTATAT
ACTTTCAATTAGCTGTACTAATTGGGGCTTGAAAGTATATAAAATCTTCCTGTCCTGTGAATTTTAAAAAGCTATCCCATATCGATTGCC
AAAGAGCATCTACCTTACCTCCTAAGAAGAAAAGCCACTTTCTTCCAATCCAAGCCCACTGCAGCCTTGTGGATTTTCCACACAGCAGCT
TTTCACTGTATGCCTGTACTTGGGCTGCACTGAGCTTGTCTTCAGGAAACCAGAGCGTTGCTTTATCATCGCACTTTTCATCTTGGTAAT
ATCAAAACAACTTTTTAAATGAACTGATTGATATATGTTATTTCTTGCGAGGTTTTCCTCTGGCCTTTAACTGGCTTCTGAGGCTACAGA
ACTCCAACCCAGAGTTCTTCGGGACCTAAATTTTGCTTAAGGAAGGCCTTTATCATGCTGAAAGCACTCAGACATGTCTGTCCTCACAGC
AGAATGTAGAAGTCATATGAATGAGGGATCGTGCACGGTAGCGTCAGCCCGAATTGACACGACAACTCTGAATGTGTGGCCCTCTATGAA
AGCTGGTGCCAGTTTTCATCACTGTTATTAAATACTAGATTGGGAACCTCATTCAGCCGTATTGCACAGATGAGCAATTACAGCAGAGAA
AATTCATTAGTGCTCCCACTCATATCCTTATGTGTGAGTTGGTGAAATTTAGCCTGAGCTTGATTCTTAGGTCTTGAGACTCAGTTTCCA
ACACCTTCATTATTAATGTTAAGAATGGCCATATACCACTTCATTTACGTAAAAGGAATAAAATAAGCAAGTTAAGCTTCAGGGTCCTAG
AATTTTTCTGATTTCTATAATCCTTCAGCAGAATATTAAGAAATAAAGCATGATCTGCAATGGAAAGGTTTTTTTGGCACTAACTTCATG
CAGAATTTCACAGACATCTATGCATTAATTTAAATTCTTGGTGCAAATGTGTGCTTTGTAGTTCAACCTTATTAAAAATTCTTCAGCCAG
TTAGGATTTCAAAATACATTAGTGAGAGTAACAGCTAGCAGAATAATTACAATGGCTAAAACGTTTTTATAGAGAATCTTGTTTTTCAAA
AAAGAATAAAAAGTTTGAATAGCTATTATTAAAGAAAAGCCATGTCTTCAACATCTGAGTCACCAAGAAGTAACACTTTTTAAACTTGTT
AGAAATCCCTGGAGGCATTTCAAATTCATCTTCTAACCTACCTAAGCACTTTAAAATACAGCCTCCTTCTGTTCCTCTGTTCCCCTTCAT
GCCTCCTTTTGAATTGATATCTCAGCTGTCAATATTTCTTTGACTTCAGCATTGTTATTTTATTTCTCTATATCAATGTGTCCTTAGTTT
TCTTAGCCTGTTAATTTAAAAATCCAGACTTGGGGGTCATTGTGTTGCTACCCAAGAGAAAATGCTACAGTTTTATAGATTGCACATCAT
TCTTTAAGGCATACTTTTACCTCAGGAAACTTACTCTAGTATGTTCTCATATATTGAATTCTCAACTAAGTAACTATTTCTTTATACCTA
TAAACTAGTACCTAATTCACTGTTAGTTAAATGAGCTATAGATAAGGCAGCTAAATTTCTGAAAGATAGCCAGAGTAAGTAAGCAGCCAC
TGCAAGCTCTGAATCAGTTTTTTAAAAAAAAGAAAAAAAAAAAAAAGGAGCTGTGCCCCATTGAACAATGACAACATCACAAGGGGAAGG
GAGGGATTTTGCCAAAAGTTAGAAAGGTGGAGCTGTAAGCCATGTGCTTGTTGCCTTTGACAGTGACAGTGCGCGTCTTACAACTAATTC
CACTAGGCATGGGAATGTCACCTCCTTTGCCACTGTACCCCATCAAGCTTACTCTGAATCAAAGGTTTTGTAAAACTTTTGAAAATGAAC
TTAGCTGCAAAATATAGCTAACCACTTTCCATTGCAAGCTTTGCAAAGTGAAGAGAGGTTCGTACTTCTCATAATTGGTATTTAGCACAA
TTGTAAGATACAGTTTTACTGTTTGTACATCGTTTTTTTCCATTAAACTTTTCTAGAGAAGACAAAAGCTTACACTGGTGACATGGATAA
GTGAGATGGTGTCTAACGAGCAGTGCAATATTAGGCGGTGCAATAGAGGCCCTGTTGGCAAGATGAGTTTTGCTGGAGAGCTGGACAGTG
TTGGTTAGCTTCCTGCATTGATTGCCCCTGGGCGTTCTTCCCCCTTAACTGTGAAAGCAGAGTCTATAAATGAACTCTTTGCTCTTACAA
GGTAATTTACATATTTTCTTTCTGTTGAAATAACTGAAAATGTTAAATCTACCAGTTTATGTCTTGTAAACAGAGTGTCATATGTATTTA
AGTTGTGTATTTTTATAAAGTAAAGCCAAGTATCAAACACCGGAAAAAAAAAAAAAAAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine145129 %
Guanine105322 %
Thyamine144729 %
Cytosine105722 %
A+T289858 %
G+C211043 %

Total Bases :   5008 bases

Microsatellites
SequencePosition LengthRepeats
GAGAGA17523
TCTCTC22923
ACACAC45223
TATATA72423
AAAAAA102123
TTTTTT125823
AGAGAG134323
TTTTTT137423
TCATCATCA138733
GAGAGA163223
AGAGAG175923
AAAAAAAAAAAA194026
GAGAGA203423
TTTTTT216223
TTTTTT219323
TCTCTC222323
TATATA260423
TATATA264423
CACACA277723
ATATAT290923
TGTGTG313123
TGTGTG326923
TTTTTT348723
TGTGTG355623
AAAAAA368623
ATATAT409723
TTTTTT424623
AAAAAA425323
AAAAAAAAAAAAAA426127
AGAGAG455023
TTTTTT462123
AAAAAAAAAAAAAAAA499228

Microsatellite Map

GTCTCCCTCCCCCGGCTCCCCACGCTCCCAACCGCCCGCGCCTGCTGCCAGGCAGCGGCGGGGATGGCGAGCAGCGGAGGCGAGGCGGTG
ACGAGAGCAGCGGCTCCGCCATTGGACGAGGAGGCCTGAGGGACGGGCCAGCGGTGCACAAGAAGAGACCGAGGCGGGTGGCCCCGAGAG
AGCCAGGGCCATGGAGGCCAACATGCCGAAGCGGAAGGAGCCCGGCAGGTCTCTCCGCATCAAAGTCATCTCCATGGGCAACGCCGAAGT
GGGGAAAAGCTGTATTATAAAGCGATACTGTGAGAAAAGATTCGTGTCTAAATACCTGGCAACAATTGGAATTGACTATGGAGTCACAAA
GGTACACGTCAGAGACAGAGAAATCAAAGTTAACATCTTTGATATGGCTGGACATCCCTTCTTCTATGAGGTTCGAAATGAGTTTTACAA
GGACACACAGGGTGTGATACTGGTCTATGATGTTGGGCAGAAAGACTCCTTTGACGCCCTTGATGCGTGGCTGGCAGAAATGAAGCAAGA
GCTTGGACCTCATGGAAACATGGAAAATATTATATTTGTAGTTTGTGCCAACAAGATTGATTGTACCAAACATCGCTGTGTAGATGAAAG
TGAAGGACGTCTTTGGGCTGAAAGCAAAGGGTTCCTGTACTTTGAAACTTCAGCACAAACTGGAGAAGGCATTAATGAGATGTTCCAGAC
CTTTTATATATCCATAGTTGATTTATGTGAAAATGGCGGGAAACGCCCTACCACCAATAGCAGTGCTAGTTTCACCAAAGAACAAGCAGA
TGCCATTCGCAGAATTCGAAATAGTAAAGACAGTTGGGACATGCTGGGAGTCAAACCTGGGGCCTCAAGGGATGAAGTCAATAAAGCGTA
TCGGAAACTTGCTGTGCTTCTTCACCCTGACAAATGTGTAGCACCTGGCAGTGAAGATGCCTTCAAAGCAGTTGTGAATGCTCGGACAGC
CCTCCTGAAAAACATCAAGTAGAAAGTACAGAAAAAAGCCACATGTGGGACTCAAATGCAAACAGACTTTCCCTAGAGGTGAAATAACCA
ACGTGGAGTTTTCCTTCCCAGAATCTCACTGCTCTTTTCATTCATGTGTTGTCATTTGTATATCAGTAATTCAGGTACCCATTTCATAGA
CATTTTACTGAGAAATGACCTGCATTTGTATGAAGTGAACTGAGCGTCACACCCTGTACTTCATTTCATATTTCTAGATAATTCTGAATT
TTTTTCTCATTCGTCAGCTCTGTAATTATAGTATCACTTAGACATTTCACTTGGGGAAATCCACAAGGTTCCTGGAGGAGGGAAGAGAGG
ACAAGAGGACCCTTTCACTTTTTCTTTTTTACGGAATTCATCATCAGAGAAGAAAATAACAAAAATGGAAGCAAACAACATCAGAACCCC
TGTAAGTTTGGTGTGACCTTACAGACAAGTTGCTGCTTTTACAATGAGTTCCTTAGGTGGTATTTTAACCCATCGATCTATAATGATGAC
TCTTGGCAGCCCTTTGGGAGTTTGTAAAATGAGGTGATACAGTTCTGAATTGAGCATTCCTTTATGATATTCACTCTGTTCCTCTTCTGC
AGCCACCAGTGGGAGAGACAAGCCAGTCCTAAGAGAAAAGGTGGTGGCAGCCACAAATTCTAGGTACACTGGCTGCTGCCTATCCTGTCC
CTGGATCTGAGGCCTTTCCCTTGCCATAGAAATGGTTGCTGGTAGCAGTAGAGAGCACTGTGCACCTGGGAATGAGGAATCAGGCCCCAA
GACAGAAGTACTTGGAGGAGCCAGCTGCAGTAGTATCCGCCTGTAGTCCCAGCTACTCAGGAGGCTGAGACAGGAGGATTGCTTAAGCCC
AGGAGCTCAAGTCCCACCTGGGCAACATAGTAAGATCTTGTCTCTTAAAGAAAAAAAAAAAAGGTACTTAGAGGTCGCACTTAAAGATTA
TGCACATCAGCAGAGGAAAGGCCAGCCAAGCTTGGGGCAAGCTTGATGCAGTAGGAGAGACTCCTTATGAGGCTTAGCCCTTGTCTTACT
GCCAGCCTTTGCCACAGGCAGGTGAGAAAGGCAGGGCCACTCCTCAGCAAAGTTGGCCTCTTCTACACTTCCTCACCAGTGTTGTTTCTT
CCTTTTTTCCCCTCTTCCCCTTCCCGTCTTGTGTTTTTTCTGAACCCCACATCTGCCATCATTTCTCTCCTCTAGAGTCCCTGGCTTCTG
GCCACTGCCTCCTCCCTCTTCTAAGCCTTGGCCTGAATCTGGTTGATCAGAGGCAAGTGTGGATCCTTTGGGTGGCAGTCAGGGGAGATC
TCAGGGCCTCTGTTGGGAGGAATCTCTGTAATTCCTGCTTGGGCTCCAAATTTCTGAAGAGTAATATTTTTAAACTATAGCTTACAAAAT
ACATTCTCTGACCACAGTCTCCTCCTTGATATACAAGGGATGGATGAAGTTCATGTATTAGGACTGGCACTCCTTACGGTGCTTATAGAA
CTAGTCTCACCACTTGACTCATTACGTCGTCATTCTTGTTACATCACTCATACTTTTAGCTGCAACCACACTAATTCACATTTTTATATA
CTTTCAATTAGCTGTACTAATTGGGGCTTGAAAGTATATAAAATCTTCCTGTCCTGTGAATTTTAAAAAGCTATCCCATATCGATTGCCA
AAGAGCATCTACCTTACCTCCTAAGAAGAAAAGCCACTTTCTTCCAATCCAAGCCCACTGCAGCCTTGTGGATTTTCCACACAGCAGCTT
TTCACTGTATGCCTGTACTTGGGCTGCACTGAGCTTGTCTTCAGGAAACCAGAGCGTTGCTTTATCATCGCACTTTTCATCTTGGTAATA
TCAAAACAACTTTTTAAATGAACTGATTGATATATGTTATTTCTTGCGAGGTTTTCCTCTGGCCTTTAACTGGCTTCTGAGGCTACAGAA
CTCCAACCCAGAGTTCTTCGGGACCTAAATTTTGCTTAAGGAAGGCCTTTATCATGCTGAAAGCACTCAGACATGTCTGTCCTCACAGCA
GAATGTAGAAGTCATATGAATGAGGGATCGTGCACGGTAGCGTCAGCCCGAATTGACACGACAACTCTGAATGTGTGGCCCTCTATGAAA
GCTGGTGCCAGTTTTCATCACTGTTATTAAATACTAGATTGGGAACCTCATTCAGCCGTATTGCACAGATGAGCAATTACAGCAGAGAAA
ATTCATTAGTGCTCCCACTCATATCCTTATGTGTGAGTTGGTGAAATTTAGCCTGAGCTTGATTCTTAGGTCTTGAGACTCAGTTTCCAA
CACCTTCATTATTAATGTTAAGAATGGCCATATACCACTTCATTTACGTAAAAGGAATAAAATAAGCAAGTTAAGCTTCAGGGTCCTAGA
ATTTTTCTGATTTCTATAATCCTTCAGCAGAATATTAAGAAATAAAGCATGATCTGCAATGGAAAGGTTTTTTTGGCACTAACTTCATGC
AGAATTTCACAGACATCTATGCATTAATTTAAATTCTTGGTGCAAATGTGTGCTTTGTAGTTCAACCTTATTAAAAATTCTTCAGCCAGT
TAGGATTTCAAAATACATTAGTGAGAGTAACAGCTAGCAGAATAATTACAATGGCTAAAACGTTTTTATAGAGAATCTTGTTTTTCAAAA
AAGAATAAAAAGTTTGAATAGCTATTATTAAAGAAAAGCCATGTCTTCAACATCTGAGTCACCAAGAAGTAACACTTTTTAAACTTGTTA
GAAATCCCTGGAGGCATTTCAAATTCATCTTCTAACCTACCTAAGCACTTTAAAATACAGCCTCCTTCTGTTCCTCTGTTCCCCTTCATG
CCTCCTTTTGAATTGATATCTCAGCTGTCAATATTTCTTTGACTTCAGCATTGTTATTTTATTTCTCTATATCAATGTGTCCTTAGTTTT
CTTAGCCTGTTAATTTAAAAATCCAGACTTGGGGGTCATTGTGTTGCTACCCAAGAGAAAATGCTACAGTTTTATAGATTGCACATCATT
CTTTAAGGCATACTTTTACCTCAGGAAACTTACTCTAGTATGTTCTCATATATTGAATTCTCAACTAAGTAACTATTTCTTTATACCTAT
AAACTAGTACCTAATTCACTGTTAGTTAAATGAGCTATAGATAAGGCAGCTAAATTTCTGAAAGATAGCCAGAGTAAGTAAGCAGCCACT
GCAAGCTCTGAATCAGTTTTTTAAAAAAAAGAAAAAAAAAAAAAAGGAGCTGTGCCCCATTGAACAATGACAACATCACAAGGGGAAGGG
AGGGATTTTGCCAAAAGTTAGAAAGGTGGAGCTGTAAGCCATGTGCTTGTTGCCTTTGACAGTGACAGTGCGCGTCTTACAACTAATTCC
ACTAGGCATGGGAATGTCACCTCCTTTGCCACTGTACCCCATCAAGCTTACTCTGAATCAAAGGTTTTGTAAAACTTTTGAAAATGAACT
TAGCTGCAAAATATAGCTAACCACTTTCCATTGCAAGCTTTGCAAAGTGAAGAGAGGTTCGTACTTCTCATAATTGGTATTTAGCACAAT
TGTAAGATACAGTTTTACTGTTTGTACATCGTTTTTTTCCATTAAACTTTTCTAGAGAAGACAAAAGCTTACACTGGTGACATGGATAAG
TGAGATGGTGTCTAACGAGCAGTGCAATATTAGGCGGTGCAATAGAGGCCCTGTTGGCAAGATGAGTTTTGCTGGAGAGCTGGACAGTGT
TGGTTAGCTTCCTGCATTGATTGCCCCTGGGCGTTCTTCCCCCTTAACTGTGAAAGCAGAGTCTATAAATGAACTCTTTGCTCTTACAAG
GTAATTTACATATTTTCTTTCTGTTGAAATAACTGAAAATGTTAAATCTACCAGTTTATGTCTTGTAAACAGAGTGTCATATGTATTTAA
GTTGTGTATTTTTATAAAGTAAAGCCAAGTATCAAACACCGGAAAAAAAAAAAAAAAA

Gene Information
Molecule Type mRNA
Bases 5008 Bases
Molecular Weight1546904.54 Da
Coding Sequence 191..1012
NCBI ReferenceNM_016544
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily C; member 27(DNAJC27); transcript variant 1; mRNA. dnaJhomologsubfamilyCmember27isoform1

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Ras 18 to 184 167 Ras family PF00071
J-domain 217 to 273 57 N-terminal DnaJ domain PF00226

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2YS8 Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA109

Accession Number

HSP40_3282

Added on

2012-02-02

Updated On

2014-01-20