Help  Custom Search
 
DnaJ homolog subfamily C member 12 isoform b of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily C member 12 isoform b

Synonymous Names

DJC12_HUMAN, Hsp40/J-protein, DnaJ homolog subfamily C member 12, J domain-containing protein 1, DNAJC12, JDP1

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE SRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGAT

FASTA Format Composition Secondary Structure

Nucleotide
 AAAGGTCTAGGATGACATCTGGTGTATTGACTGTGGCCAGTCTTAAAGCTAGTTTTTGCTATGTGGAACATGCTGCTCTAATTCAGATT
TAAAGAGTTTCTTCCTGTTAATTCGAAGCTCACTGTGCCTCTTGTTTCCGAGGGAAGAAGGACTGATTAAGTCATCTAAATGGATGCAAT
ACTGAATTACAGGTCAGAAGATACTGAAGATTACTACACATTACTGGGATGTGATGAACTATCTTCGGTTGAACAAATCCTGGCAGAATT
TAAAGTCAGAGCTCTGGAATGTCACCCAGACAAGCATCCTGAAAACCCCAAAGCTGTGGAGACTTTTCAGAAACTGCAGAAGGCAAAGGA
GATTCTGACCAATGAAGAGAGTCGAGCCCGCTATGACCACTGGCGAAGGAGCCAGATGTCGATGCCATTCCAGCAGTGGGAAGCTTTGAA
TGACTCAGTGAAGACGGTGGGTTTCTCGCTGGGTGCGACGTGAATTTGTGAAGCTCAGGATGCCCATGGATTAGACTCATGTAGTAGCTT
AAAGAGTCATTAGGCGATAGGAGGGAGAAAACCAAGAAGTTAGCAGAGTCTGGATATAATTCAGTGTCCGTAAATCCCATGAAGAGAAGC
TCATCAGAATAAAGGCAATGAATTTGTGCCAGAAGAGCCTGTGACTACATTTCTTTCAATCTCTTTGGCTGTTTGTTTCAGTATACACAC
TCCCTGTTATTGCTTACTATTTTATGAGCTCTAATAAATGTACTTCTCAAGTTGCTCATGAAAAAAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine23631 %
Guanine18724 %
Thyamine21728 %
Cytosine14619 %
A+T45358 %
G+C33343 %

Total Bases :   786 bases

Microsatellites
SequencePosition LengthRepeats
AGAGAG37423
ACACAC71323
AAAAAA77923

Microsatellite Map

AAAGGTCTAGGATGACATCTGGTGTATTGACTGTGGCCAGTCTTAAAGCTAGTTTTTGCTATGTGGAACATGCTGCTCTAATTCAGATTT
AAAGAGTTTCTTCCTGTTAATTCGAAGCTCACTGTGCCTCTTGTTTCCGAGGGAAGAAGGACTGATTAAGTCATCTAAATGGATGCAATA
CTGAATTACAGGTCAGAAGATACTGAAGATTACTACACATTACTGGGATGTGATGAACTATCTTCGGTTGAACAAATCCTGGCAGAATTT
AAAGTCAGAGCTCTGGAATGTCACCCAGACAAGCATCCTGAAAACCCCAAAGCTGTGGAGACTTTTCAGAAACTGCAGAAGGCAAAGGAG
ATTCTGACCAATGAAGAGAGTCGAGCCCGCTATGACCACTGGCGAAGGAGCCAGATGTCGATGCCATTCCAGCAGTGGGAAGCTTTGAAT
GACTCAGTGAAGACGGTGGGTTTCTCGCTGGGTGCGACGTGAATTTGTGAAGCTCAGGATGCCCATGGATTAGACTCATGTAGTAGCTTA
AAGAGTCATTAGGCGATAGGAGGGAGAAAACCAAGAAGTTAGCAGAGTCTGGATATAATTCAGTGTCCGTAAATCCCATGAAGAGAAGCT
CATCAGAATAAAGGCAATGAATTTGTGCCAGAAGAGCCTGTGACTACATTTCTTTCAATCTCTTTGGCTGTTTGTTTCAGTATACACACT
CCCTGTTATTGCTTACTATTTTATGAGCTCTAATAAATGTACTTCTCAAGTTGCTCATGAAAAAAA

Gene Information
Molecule Type mRNA
Bases 786 Bases
Molecular Weight243649.55 Da
Coding Sequence 169..492
NCBI ReferenceNM_201262
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily C; member 12(DNAJC12); transcript variant 2; mRNA. dnaJhomologsubfamilyCmember12isoformb

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 14 to 76 63 N-terminal DnaJ domain PF00226

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2CTQ Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA92

Accession Number

HSP40_3265

Added on

2012-02-02

Updated On

2014-01-20