Help  Custom Search
 
DnaJ homolog subfamily C member 30 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily C member 30

Synonymous Names

DJC30_HUMAN, Hsp40/J-protein, Williams-Beuren syndrome chromosomal region 18 protein, DNAJC30, WBSCR18

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MAAMRWRWWQRLLPWRLLQARGFPQNSAPSLGLGARTYSQGDCSYSRTALYDLLGVPSTATQAQIKAAYY RQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPGVRPSRTPAPDPGSPRT PPPTSRTHDGSRASPGANRTMFNFDAFYQAHYGEQLERERRLRARREALRKRQEYRSMKGLRWEDTRDTA AIFLIFSIFIIIGFYI

FASTA Format Composition Secondary Structure

Nucleotide
 CTTGCACCGCCTGCCGAATCAATTCAACATGGCAGCCATGCGCTGGCGATGGTGGCAGCGGCTGTTACCTTGGAGGTTGCTGCAGGCCC
GTGGCTTTCCACAAAATTCTGCACCCAGCCTGGGCCTAGGAGCGAGGACTTATTCCCAGGGCGACTGCTCGTATTCGCGCACGGCGCTGT
ATGATCTGCTCGGCGTCCCCTCCACAGCCACGCAGGCCCAAATCAAGGCGGCTTACTACCGTCAGTGCTTTCTCTACCACCCGGACCGCA
ACTCCGGGAGCGCGGAGGCCGCCGAGCGCTTCACGCGCATCTCCCAGGCCTACGTGGTGCTGGGCAGTGCCACCCTCCGTCGCAAGTATG
ATCGCGGCCTACTCAGCGACGAGGACCTGCGCGGACCTGGCGTCCGGCCCTCCAGGACGCCCGCACCCGACCCCGGCTCGCCGCGTACCC
CGCCGCCCACCTCTCGGACCCACGACGGTTCTCGGGCCTCCCCCGGCGCCAACCGCACGATGTTCAACTTTGACGCCTTCTACCAGGCCC
ACTACGGGGAACAACTGGAGCGGGAACGGCGCCTGAGGGCCCGGCGGGAGGCCCTTCGCAAACGGCAGGAGTATCGGTCCATGAAAGGCC
TCCGCTGGGAGGATACCCGAGACACGGCTGCCATTTTCCTCATCTTTTCAATCTTCATCATCATCGGCTTTTATATTTAATCGGAGAGAG
AAGGGAAGGGGAGTGTCCCCAGCCAACCCCCCAGAAACGGCCTTTTTTCCTGCCTCTGAACCCTTGGCCATTGATAGTCTACCTTTGCTG
GGATCCGAAGGAACTGTACTCCCCCTGCCCTCCCCGACCCGCCCAGCTTAGCCGATGACCTGCACATCGCTCCACTGTGGTCCAGAAAAG
GAGGCCTTTCGATGTCTGAGAAAGAGGCCCCACGCTGTAGAGTCCCGAAAGCCCAGGAGTGAAGGGGGTTCCTGGAGTCTCTAGGGTGCT
TCTTCCAGAGTCTGTCTTCTTGCTTCCAGATGTGGTCAACTTCTGGAACACTCGCTGTAGCTTTATTGTTTAGCCCCAAGCAAGATTTAT
CTCCTCCTGCCCCGCATGTGTATGGTGGGCCTCTGTAACCTTGAAATGTGCAATGTGACCAATTGTTGACTACCAAAAGAAAAGGTCTGG
GGTTGTACGAAACTTGTCTTTCTGTGACTTCCCCAAGCCGCAGGTGAGACCTGGTCCAGGGTAAGAATGGGATCGGTGGAGAGCCTGTCG
TTCCTCCCGCTAAGGTCAGCCCCCTGGGGCACTCCTCCTTATGTTGATAGCATGTAGGAGTGAGAAAAAGTCATTGAGCATAAGGAATGA
GTGTTCCTGTGCCCATATTTAATGTGTGACCTTGGAGAAGTTACTCTGTAGGCATGACAGCAGAGGAGAAAATCATTTGGCATCTTGAGG
TCTGTCATGCTTTATTATCCATAGTTTTTGGGGGGTTTTTTGTTTTGTTTTGTTTTTGAGATGGAGTCTTGCGCTCTGTTGCCCAGGCTG
GAGTGCAGTGGTGCGATCTTAGCTCACTGCAACCTCCACCTCCCGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGTGTAACTGGGATT
ACAGGCTCCCACCACACCTGGCTAGTGTTTTGTATTTTTAGTAGATACGGGGTTTCACCATGCTGGCCAGACTGAGGTCTCGAACTGCCG
ACCTCAGGCTGTCTGCCCGTCCAGCCTCCCAAAGTGCTGGGATTGCAGGCATGAGCCACTGCTCCCGGCCCTATTATCCATAGTTCTAAT
CCACAGGGATTACAGCATAATGCTAGCAGGGCCAGGTTCATCCTTGAGACAGTGTGGCTGGCTGTCACCTGGTCCTCCCTTTACCAGCCA
GCCCCATTGCACACTGTGCAGCCCATCCCCTCCCAGAAATAGAGTGACAAACTCTGCACTTAAGTCCCCTGTTTCTGTTTAACTTGCAGT
GCTTATCACAGGCCCTTCCTTAATTTTTTAAACAAGGCTGCTTGAGGCTGGGGTAAATTTTGGGGCTTTGGGAGTACACAGGACTACTGA
GGGACGGGGAGTTGGTGGCTTGGTGTTCATGGTGGAGACTTGGTTCTTTACGCAGAGCAGGCTAAAGGCGTGTTTTTTCTGCTCTGTTTC
TAATTCATGTTAAGTAGTTGGTCATCACTTTGGTCAGAGCTGCTGCTGAAGCTCTCTTAACTGTGAGTCACTGGACGTTGGCAGGGAGTT
GGCTGTGAGATTGTAGGTGCTCAAGTGTTTCTGTTCGGGACTGAGTGTGAATCTGTAAAAGGGGAAAATCCTCGCAAGAGGTCTACGAGA
AGGATGAGGGCCCAAGTCTAGGGTCTAAACAAAGCCAGGAGTGGTTTGGTATATTACTGAGTGCAATCATTGCGTGCCATTCCTGCACTC
AATGTATTGTGTAAAATCCTTAGGTAAAATGGGATAAACCCACAGCTGGTCCTACTTGGCCTCTTGAAAACCATTCCATCATTGTGCCAA
TCTAGCCTGAAAAGG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine51921 %
Guanine67727 %
Thyamine64026 %
Cytosine69828 %
A+T115946 %
G+C137555 %

Total Bases :   2534 bases

Microsatellites
SequencePosition LengthRepeats
TCATCATCA68333
GAGAGAGA71224
CCCCCC74523
TTTTTT76123
TGTGTG137123
GGGGGG146823
TTTTGTTTTGTTTTG147653
TTTTTT200223
TTTTTT214123
GCTGCTGCT219733
CTCTCT221023

Microsatellite Map

CTTGCACCGCCTGCCGAATCAATTCAACATGGCAGCCATGCGCTGGCGATGGTGGCAGCGGCTGTTACCTTGGAGGTTGCTGCAGGCCCG
TGGCTTTCCACAAAATTCTGCACCCAGCCTGGGCCTAGGAGCGAGGACTTATTCCCAGGGCGACTGCTCGTATTCGCGCACGGCGCTGTA
TGATCTGCTCGGCGTCCCCTCCACAGCCACGCAGGCCCAAATCAAGGCGGCTTACTACCGTCAGTGCTTTCTCTACCACCCGGACCGCAA
CTCCGGGAGCGCGGAGGCCGCCGAGCGCTTCACGCGCATCTCCCAGGCCTACGTGGTGCTGGGCAGTGCCACCCTCCGTCGCAAGTATGA
TCGCGGCCTACTCAGCGACGAGGACCTGCGCGGACCTGGCGTCCGGCCCTCCAGGACGCCCGCACCCGACCCCGGCTCGCCGCGTACCCC
GCCGCCCACCTCTCGGACCCACGACGGTTCTCGGGCCTCCCCCGGCGCCAACCGCACGATGTTCAACTTTGACGCCTTCTACCAGGCCCA
CTACGGGGAACAACTGGAGCGGGAACGGCGCCTGAGGGCCCGGCGGGAGGCCCTTCGCAAACGGCAGGAGTATCGGTCCATGAAAGGCCT
CCGCTGGGAGGATACCCGAGACACGGCTGCCATTTTCCTCATCTTTTCAATCTTCATCATCATCGGCTTTTATATTTAATCGGAGAGAGA
AGGGAAGGGGAGTGTCCCCAGCCAACCCCCCAGAAACGGCCTTTTTTCCTGCCTCTGAACCCTTGGCCATTGATAGTCTACCTTTGCTGG
GATCCGAAGGAACTGTACTCCCCCTGCCCTCCCCGACCCGCCCAGCTTAGCCGATGACCTGCACATCGCTCCACTGTGGTCCAGAAAAGG
AGGCCTTTCGATGTCTGAGAAAGAGGCCCCACGCTGTAGAGTCCCGAAAGCCCAGGAGTGAAGGGGGTTCCTGGAGTCTCTAGGGTGCTT
CTTCCAGAGTCTGTCTTCTTGCTTCCAGATGTGGTCAACTTCTGGAACACTCGCTGTAGCTTTATTGTTTAGCCCCAAGCAAGATTTATC
TCCTCCTGCCCCGCATGTGTATGGTGGGCCTCTGTAACCTTGAAATGTGCAATGTGACCAATTGTTGACTACCAAAAGAAAAGGTCTGGG
GTTGTACGAAACTTGTCTTTCTGTGACTTCCCCAAGCCGCAGGTGAGACCTGGTCCAGGGTAAGAATGGGATCGGTGGAGAGCCTGTCGT
TCCTCCCGCTAAGGTCAGCCCCCTGGGGCACTCCTCCTTATGTTGATAGCATGTAGGAGTGAGAAAAAGTCATTGAGCATAAGGAATGAG
TGTTCCTGTGCCCATATTTAATGTGTGACCTTGGAGAAGTTACTCTGTAGGCATGACAGCAGAGGAGAAAATCATTTGGCATCTTGAGGT
CTGTCATGCTTTATTATCCATAGTTTTTGGGGGGTTTTTTGTTTTGTTTTGTTTTTGAGATGGAGTCTTGCGCTCTGTTGCCCAGGCTGG
AGTGCAGTGGTGCGATCTTAGCTCACTGCAACCTCCACCTCCCGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGTGTAACTGGGATTA
CAGGCTCCCACCACACCTGGCTAGTGTTTTGTATTTTTAGTAGATACGGGGTTTCACCATGCTGGCCAGACTGAGGTCTCGAACTGCCGA
CCTCAGGCTGTCTGCCCGTCCAGCCTCCCAAAGTGCTGGGATTGCAGGCATGAGCCACTGCTCCCGGCCCTATTATCCATAGTTCTAATC
CACAGGGATTACAGCATAATGCTAGCAGGGCCAGGTTCATCCTTGAGACAGTGTGGCTGGCTGTCACCTGGTCCTCCCTTTACCAGCCAG
CCCCATTGCACACTGTGCAGCCCATCCCCTCCCAGAAATAGAGTGACAAACTCTGCACTTAAGTCCCCTGTTTCTGTTTAACTTGCAGTG
CTTATCACAGGCCCTTCCTTAATTTTTTAAACAAGGCTGCTTGAGGCTGGGGTAAATTTTGGGGCTTTGGGAGTACACAGGACTACTGAG
GGACGGGGAGTTGGTGGCTTGGTGTTCATGGTGGAGACTTGGTTCTTTACGCAGAGCAGGCTAAAGGCGTGTTTTTTCTGCTCTGTTTCT
AATTCATGTTAAGTAGTTGGTCATCACTTTGGTCAGAGCTGCTGCTGAAGCTCTCTTAACTGTGAGTCACTGGACGTTGGCAGGGAGTTG
GCTGTGAGATTGTAGGTGCTCAAGTGTTTCTGTTCGGGACTGAGTGTGAATCTGTAAAAGGGGAAAATCCTCGCAAGAGGTCTACGAGAA
GGATGAGGGCCCAAGTCTAGGGTCTAAACAAAGCCAGGAGTGGTTTGGTATATTACTGAGTGCAATCATTGCGTGCCATTCCTGCACTCA
ATGTATTGTGTAAAATCCTTAGGTAAAATGGGATAAACCCACAGCTGGTCCTACTTGGCCTCTTGAAAACCATTCCATCATTGTGCCAAT
CTAGCCTGAAAAGG

Gene Information
Molecule Type mRNA
Bases 2534 Bases
Molecular Weight781904.84 Da
Coding Sequence 29..709
NCBI ReferenceNM_032317
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily C; member 30(DNAJC30); mRNA. dnaJhomologsubfamilyCmember30precursor

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
SignalP 1 to 38 38 Signal peptide region Manually identified
J-domain 49 to 111 63 N-terminal DnaJ domain PF00226
TMhelix 208 to 226 19 Transmembrane helix region Manually identified

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2YUA Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA84

Accession Number

HSP40_3257

Added on

2012-02-02

Updated On

2014-01-20