Help  Custom Search
 
DnaJ homolog subfamily B member 3 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily B member 3

Synonymous Names

DNJB3_HUMAN, Hsp40/J-protein, DNAJB3

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGE AGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTP FLCLQ

FASTA Format Composition Secondary Structure

Nucleotide
 AGGCGGCCCAGGTCTCCGAGCACTCGGGCCTGCGCCTGGGTGCTGGCAGCCTTGCCGCTCGCTGTGCCAGTGCCTGGTGGGCCGTTCTG
GCCATCCAGCATGGTGGACTACTACGAGGTGCTGGACGTGCCCCGGCAGGCCTCATCCGAGGCCATCAAGAAGGCGTACCGCAAGCTGGC
GCTCAAGTGGCACCCCGACAAAAACCCTGAGAACAAGGAGGAAGCGGAGAGGAGATTCAAGCAGGTGGCCGAGGCCTACGAGGTGTTGTC
GGACGCCAAGAAACGCGATATCTATGACCGCTATGGCGAGGCGGGGGCGGAGGGCGGCTGCACAGGCGGCAGGCCCTTCGAGGACCCCTT
CGAGTACGTCTTCAGCTTCCGCGACCCAGCCGACGTCTTCAGGGAGTTCTTCGGCGGCCAGGACCCATTCTCCTTTGACCTCTTGGGAAA
CCCGCTGGAGAATATTTTGGGGGGGTCAGAGGAACTGCTGGGGAAGCAGAAGCAGAGCGTCTGCACCCCTTTTCTCTGCCTTCAGTGAAT
TTCCAGCTTTTGGGGGTGTTTTTTCTTCTTTTGATACAGGATTTCGTTCCTTTGGCTCCCTGGGAAGTGGGGGCCTTTCTTCCTTCTGCA
TGTCCTACGGTAGTGATGGGACAGGCAGCTTCAAGTCCATGTCGACTTCCACTGAAATAGTTGATGGTAAAAAAATCACCACCAAGAGAA
TCATTGAGAATGGCCAAGAAAGGGTGGAAGTGGAGGAAGATGGAGAGTTGAGTTAAAGTCCTTCATAATAAATAGCAAAGAGCAGTTACT
CCGCATTGACACCAAGTAATTCCAGTCCACATTTGACTTTAAGCACATCTGGAGGAATAGCGGACTTTTTTTAGGATTGAAAGTGAACTT
TACTTTCAGAACAGCTGTACCCAAGAATTTATAAACACTTCATGCCAACACCTGTTCTTATCGTTGGGACTACACGGATAGGACCTCTGT
TTGTCTTTCAATCGTTGTAAAATATCTGTATGCAATTTGCTATTTATTAAACTTAAGCCTGAGGCAGACAATGATTATTTGCTAGTGGTA
GGACAGAATGTTCAGTTCAGCACTTTGAGCATTACCTTTTTCCGTTGGGAAAGTGTGAGCCAGGTGGTTTGCTCTAAATCATTTGACTTT
ATTGTTTAGTGTGTAGTGGTGAAATCTACAAATAATATCAATACTTCTGGCTTAATTTAATGATGGTTCAAAACAACATGCATTTATTAT
CTTAATA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine30925 %
Guanine33727 %
Thyamine33427 %
Cytosine28623 %
A+T64351 %
G+C62350 %

Total Bases :   1266 bases

Microsatellites
SequencePosition LengthRepeats
GGGGGG46723
TTTTTT55723
AAAAAA69723
TTTTTT87423
GTGTGT117723

Microsatellite Map

AGGCGGCCCAGGTCTCCGAGCACTCGGGCCTGCGCCTGGGTGCTGGCAGCCTTGCCGCTCGCTGTGCCAGTGCCTGGTGGGCCGTTCTGG
CCATCCAGCATGGTGGACTACTACGAGGTGCTGGACGTGCCCCGGCAGGCCTCATCCGAGGCCATCAAGAAGGCGTACCGCAAGCTGGCG
CTCAAGTGGCACCCCGACAAAAACCCTGAGAACAAGGAGGAAGCGGAGAGGAGATTCAAGCAGGTGGCCGAGGCCTACGAGGTGTTGTCG
GACGCCAAGAAACGCGATATCTATGACCGCTATGGCGAGGCGGGGGCGGAGGGCGGCTGCACAGGCGGCAGGCCCTTCGAGGACCCCTTC
GAGTACGTCTTCAGCTTCCGCGACCCAGCCGACGTCTTCAGGGAGTTCTTCGGCGGCCAGGACCCATTCTCCTTTGACCTCTTGGGAAAC
CCGCTGGAGAATATTTTGGGGGGGTCAGAGGAACTGCTGGGGAAGCAGAAGCAGAGCGTCTGCACCCCTTTTCTCTGCCTTCAGTGAATT
TCCAGCTTTTGGGGGTGTTTTTTCTTCTTTTGATACAGGATTTCGTTCCTTTGGCTCCCTGGGAAGTGGGGGCCTTTCTTCCTTCTGCAT
GTCCTACGGTAGTGATGGGACAGGCAGCTTCAAGTCCATGTCGACTTCCACTGAAATAGTTGATGGTAAAAAAATCACCACCAAGAGAAT
CATTGAGAATGGCCAAGAAAGGGTGGAAGTGGAGGAAGATGGAGAGTTGAGTTAAAGTCCTTCATAATAAATAGCAAAGAGCAGTTACTC
CGCATTGACACCAAGTAATTCCAGTCCACATTTGACTTTAAGCACATCTGGAGGAATAGCGGACTTTTTTTAGGATTGAAAGTGAACTTT
ACTTTCAGAACAGCTGTACCCAAGAATTTATAAACACTTCATGCCAACACCTGTTCTTATCGTTGGGACTACACGGATAGGACCTCTGTT
TGTCTTTCAATCGTTGTAAAATATCTGTATGCAATTTGCTATTTATTAAACTTAAGCCTGAGGCAGACAATGATTATTTGCTAGTGGTAG
GACAGAATGTTCAGTTCAGCACTTTGAGCATTACCTTTTTCCGTTGGGAAAGTGTGAGCCAGGTGGTTTGCTCTAAATCATTTGACTTTA
TTGTTTAGTGTGTAGTGGTGAAATCTACAAATAATATCAATACTTCTGGCTTAATTTAATGATGGTTCAAAACAACATGCATTTATTATC
TTAATA

Gene Information
Molecule Type mRNA
Bases 1266 Bases
Molecular Weight391971.98 Da
Coding Sequence 100..537
NCBI ReferenceNM_001001394
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily B; member 3 (DNAJB3);mRNA. dnaJhomologsubfamilyBmember3

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 3 to 66 64 N-terminal DnaJ domain PF00226

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2EJ7 Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA55

Accession Number

HSP40_3228

Added on

2012-02-02

Updated On

2014-01-20