Help  Custom Search
 
DnaJ homolog subfamily B member 12 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily B member 12

Synonymous Names

DJB12_HUMAN, Hsp40/J-protein, DNAJB12

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MSSLRARLPATRRRVAQPFARPASPSLVPRSGSAMESNKDEAERCISIALKAIQSNQPDRALRFLEKAQR LYPTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRKAGGTDAPSANGEAGGESTKGYTAEQVAAVKRVK QCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDD KSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGV FVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERN VEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG

FASTA Format Composition Secondary Structure

Nucleotide
 GTTGGCGCATACTCAACTCTAAGACCTCCGGAACATGGAATCTGGGCGTGCACCATTATTGACACCTACACCAGCCGTCCCTTTCTTAG
AAGACATACGGTAGCACTTCCACCCTCGCTCAAAACTCGGGAAAGGAGGGGCGGAGGGTGGATGTCATCACTCCGCGCCCGGCTGCCCGC
GACGCGCCGGCGGGTGGCGCAGCCCTTCGCTCGCCCGGCCTCCCCCTCCCTGGTTCCGCGTTCTGGTTCCGCCATGGAATCCAACAAGGA
TGAAGCTGAGCGCTGTATCAGCATCGCCCTCAAGGCCATCCAGAGCAACCAGCCCGACCGGGCGCTCCGCTTCCTGGAGAAGGCACAGCG
GCTGTATCCGACGCCGCGAGTTCGCGCCCTGATTGAGTCCCTCAACCAGAAACCACAGACTGCCGGTGACCAACCCCCACCCACAGACAC
AACCCATGCCACCCACAGGAAAGCAGGTGGGACCGATGCCCCCTCGGCCAACGGTGAAGCTGGAGGAGAGAGCACCAAAGGCTACACTGC
AGAACAGGTTGCAGCTGTGAAAAGGGTCAAGCAATGTAAAGATTACTATGAGATCCTGGGGGTGAGCAGAGGGGCCTCGGATGAGGACCT
GAAGAAGGCCTACCGCAGACTGGCCCTCAAATTCCACCCAGACAAGAACCACGCACCTGGTGCCACTGAAGCCTTCAAAGCCATTGGCAC
AGCATATGCGGTACTCAGCAACCCGGAGAAGAGGAAGCAGTATGACCAGTTCGGCGATGACAAGAGCCAGGCGGCCCGGCACGGCCATGG
GCATGGGGATTTCCACCGTGGCTTTGAGGCCGACATCTCCCCTGAAGACCTCTTCAACATGTTCTTTGGCGGCGGCTTCCCTTCTAGTAA
CGTCCACGTCTACAGCAACGGCCGCATGCGCTATACCTACCAGCAAAGGCAGGACCGCAGGGACAACCAGGGTGATGGCGGGCTAGGGGT
GTTTGTGCAGCTGATGCCTATCCTCATCCTGATTCTCGTGTCAGCTCTCAGCCAGCTCATGGTCTCCAGTCCACCCTACAGTCTGAGTCC
AAGACCGTCCGTGGGCCACATCCACAGGCGAGTCACTGACCACCTGGGTGTCGTCTACTATGTGGGAGACACTTTCTCCGAAGAGTACAC
AGGCTCCAGCCTCAAAACAGTCGAGCGGAATGTGGAAGATGATTATATCGCCAACCTCCGGAACAACTGCTGGAAGGAGAAGCAGCAGAA
GGAAGGCTTGCTGTACCGGGCACGCTACTTTGGCGACACAGATATGTACCACAGAGCACAGAAGATGGGCACCCCCAGCTGCAGCCGACT
GTCAGAGGTGCAGGCCTCCCTGCATGGATAGTCCTGGGCCAGCCACACCACCGAGGTCCAAGTATGAGCCAGGGCTGCCTCCACCCTGCA
ACTCCTGGCAGCTTTGGCCCTGGTCATGAGCAGAGGAGGGAGGGGGAGAAAGGGAGGAAGCCTGGTGATTGTGGCAAAGACTCCTGTCCC
CAGCCTGACCTCCAGCCTCCAGAGACCGAGCAGCTGTGGGGCCTGCTGGGAAACCAAGGTCGGTTTCCGCCCTCTAGCGATGCTGTCCTC
CCCACTCCTCCGCTCTGCTCCCTGGCTCCAGGGGTGTGGGGGACCCCAGAACCAGGCAGAGTGGGAACTTGAAACTGTTGCTGAGGGCCA
CCCGGGGCTTCTTGGTCCACTCCAGCCATCAGTCAGCACGGCCCTTTCTCCAGCACAGCAGACTATTGTCCGTGCCCTGGTATTTAGGCC
ATCACATATGGTGGGGCCCAAGAGAGCCCCATATGCACACTGCCTGCCTGATACCAGGAAGAACCATGTGGGAATAGGTGGGCCAAGAGC
CCTCCCCTTTCTCCATCCCTCCAGCTAGGAGGAAATGGAGCAAGATGAACAGGCAGCCACGAGGTGGGTGGGAGCTGGCAGTCTTGGTGG
CGGCAGGGGCCGCGGGCCCTGACCACCCCCCTCTGGTGGGATCTGAGGCACTCTCTCGAATGCCGTCACACCTGGCAGCCTGGAAGCCAC
AGGCATCCGGCCTTGCCCAGGCATCTCGCCTGCGGTCTGAGGAAGGGAACAGAAGGTCATGAGTTCAGGGTCAGACGCAGCCGCTCAGCA
CAGGAGGGGTGGAGGGGAAATGAGAGTTGCTGGTAGCAGGCTCCCTCCTTCTGCAGCCCGGCGAATGGGGGCGCTGGGCTCTGTTCCCAG
CGTTTGCCAGAGGTGGCCACTTCAGCCAAGCCCAGAGAAGTGTGGGCAGAAGCAGTGAAGGTTCTTCTCTGTGTGGGTGCCCTGCCCACC
CCCTCCTTTGCCTGTGTCCTCCCGGCCTGGATCCATGGCTGACTCTGCCTGGAGGCCATTTGTGCCTGCCTCTGTGCTGCCGCAGGAGGG
CAGGCCGCAAGTGGGGTTGGTGGGGGTCGAGCGGGCAGCACGGTGCAGCGGTGCAGTGGCAAGGGGGGCTACTTGTGTGGCATAAGCTAG
AGGAGCCGGTGCCGCCTGAATGCCGAGCTAACTGTTGCCACTCTCCTCCCCAGACTATGAAATCCCTGGAGAATTTTTGGTGACATGCAC
TGAGCCAAGGTGATGGACTGTATATTTGAGGAAAGACAAACAAAGAAACAAAATTAAAATGGAATTGGAGGCCGAACGCTGCACAGCTGC
CCTCTCTCTCACCCAGTAAATGCAGAAAGCTCTTAGGACAGACAGAAAACCTGCCATGGGGCTGCTTCCCTCCCTCGCAGGGCTGGCGGA
GGCTCCGCATCGCCTCTCTCCTAGGATACAGAAACCATGGCAACGAAAGTAGAATGTAAAACTCGCAGCAGATATCAGTGGGAAGGGCTG
GGGGAGGGGGCACCCAGCTGCCTTTCCTCCCTCACAGGAGCCACCACCAGCCACCTCTCAGGAGAAGCCAGAGGCCCTGGCCAAAGATAG
GAGGAAGAAAGAGAACTCTCCATAGAATGTAATTTATAGATGCGTGTATATGTATATATATCTATTTATATGTAAATAGGCATATATGAA
GATATATATATATATAGTCTACTTTTTAAACTCTGCAGGGATTTGGTTAAGTTGTTGAGCTGATTTCTTCCATGTTTTAGAAAATGAGGC
CTGTTTGGGGAAGGTACCCTGGTGATGTTTTTGCTAGACATTAGCTGTAGCTGACAGCATAAGGAGAGTCGCATCAGAGCTTTTCACAGC
CCCCCGAAACCCCAGCCTGGTTTTGATGGCAGCAGTAATCATGATAGTGTGAACCCGCGAAGGCCTCAGGATTATGGTTAACCTGGAGAG
GAGCAGGCCATGGAGGCAGGTGCCAGGTCAGTATTGAGTCACAGTAGAGGCCCCACAAGGACCTGCTTGGGTGAGACCACCTCTCCCCTC
TCAGCAGCGCTGGTGGGCTCTTTGTCCTGGTGCCCAGGAGCCCTCCAGCCCCCTGCCCACAGAAGGGAAGGCCTGCAGAGGGGGCCAGGA
TCTACCTAACCATTTCCCCACCCCTAAGTCCCTCAGTGGGCTTTGCCTTATAGGTGCCACAGGGCACAGCTCCATCATTGCCACTGGTTT
TTCCTAAGTCATGCACCAAGGACTTCAGAAAGTTCTTCCTCCGAGTCAGTCAGTGGTGCCGGGACCCCAGGGCAGCCTCCTCGACTCCTG
AAGAAAAGGCAGTGCCCGTGGCTGCCTCTGTCTTCACTCGCTGTTGATGTGACCGCCAGGCCTCCTCTCGTACCTTGGACAAAGGATACA
CCTGAACCAGAATAGTTTTCTTACCCTCACATTGAAATGAGGATTTTGCTTAAAACAGCACTTGCCGCCAGTGGGAGGAGGGAGGTTTTA
TTTATTCCCACAGTTTCTCCTGGGCCTTCTGGAATGACCATGTTTTCCTGTGGCGGTGGGTGTGTCATTGCGCCCGCCGTCTTCCAAAGC
CTTACTTCCCCAAGCTGCCAGCCAGGAGGTGATAACCACCCTCCCAGAGTTTCTCTCGGCTCTTTTTTTAAAAGTCCCCCAACAAATAGG
ATTCTTGCTGGGAAAGGAAGTTCGGTAAGGAAATGTCAAATCTGGTTTTTAAACAAGGTCCAACCCTGCAATGAAGCAGCCACTTCAGCC
CAGAGAGATTATAAGAACTGATGTGGCCAGAGTGCCTACCCACTGTGGCCCCGGTGCTCTGCCCCCACGCCCCGACCATCTGGTCTTGGT
AGATGTCCCTAGACGGGCTGAGCCATGTGCAATAAGAACATAGATCCTAAAGGATCCTCTGGAAGCTGTATTTCTTGAATTAGAATTCTC
AAATTGTACATCTGTTAATATATGTTTATTATGTGACTGGCAAAAAAAAAAAAAAAAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine101824 %
Guanine121728 %
Thyamine89721 %
Cytosine124529 %
A+T191544 %
G+C246257 %

Total Bases :   4377 bases

Microsatellites
SequencePosition LengthRepeats
GAGAGA51423
GGCGGCGGC87633
AGAGAG181923
CCCCCC200423
CTCTCT202923
TGTGTG231823
GGGGGG249123
TGTGTG250223
CTCTCTCT270024
CTCTCT280223
CCACCACCA291933
TATATATA302124
ATATAT305023
ATATATATATATAT306027
CCCCCC323823
GTGTGT392823
TCTCTC401023
TTTTTT402123
AGAGAG414023
ATATAT433623
AAAAAAAAAAAAAAAA436028

Microsatellite Map

GTTGGCGCATACTCAACTCTAAGACCTCCGGAACATGGAATCTGGGCGTGCACCATTATTGACACCTACACCAGCCGTCCCTTTCTTAGA
AGACATACGGTAGCACTTCCACCCTCGCTCAAAACTCGGGAAAGGAGGGGCGGAGGGTGGATGTCATCACTCCGCGCCCGGCTGCCCGCG
ACGCGCCGGCGGGTGGCGCAGCCCTTCGCTCGCCCGGCCTCCCCCTCCCTGGTTCCGCGTTCTGGTTCCGCCATGGAATCCAACAAGGAT
GAAGCTGAGCGCTGTATCAGCATCGCCCTCAAGGCCATCCAGAGCAACCAGCCCGACCGGGCGCTCCGCTTCCTGGAGAAGGCACAGCGG
CTGTATCCGACGCCGCGAGTTCGCGCCCTGATTGAGTCCCTCAACCAGAAACCACAGACTGCCGGTGACCAACCCCCACCCACAGACACA
ACCCATGCCACCCACAGGAAAGCAGGTGGGACCGATGCCCCCTCGGCCAACGGTGAAGCTGGAGGAGAGAGCACCAAAGGCTACACTGCA
GAACAGGTTGCAGCTGTGAAAAGGGTCAAGCAATGTAAAGATTACTATGAGATCCTGGGGGTGAGCAGAGGGGCCTCGGATGAGGACCTG
AAGAAGGCCTACCGCAGACTGGCCCTCAAATTCCACCCAGACAAGAACCACGCACCTGGTGCCACTGAAGCCTTCAAAGCCATTGGCACA
GCATATGCGGTACTCAGCAACCCGGAGAAGAGGAAGCAGTATGACCAGTTCGGCGATGACAAGAGCCAGGCGGCCCGGCACGGCCATGGG
CATGGGGATTTCCACCGTGGCTTTGAGGCCGACATCTCCCCTGAAGACCTCTTCAACATGTTCTTTGGCGGCGGCTTCCCTTCTAGTAAC
GTCCACGTCTACAGCAACGGCCGCATGCGCTATACCTACCAGCAAAGGCAGGACCGCAGGGACAACCAGGGTGATGGCGGGCTAGGGGTG
TTTGTGCAGCTGATGCCTATCCTCATCCTGATTCTCGTGTCAGCTCTCAGCCAGCTCATGGTCTCCAGTCCACCCTACAGTCTGAGTCCA
AGACCGTCCGTGGGCCACATCCACAGGCGAGTCACTGACCACCTGGGTGTCGTCTACTATGTGGGAGACACTTTCTCCGAAGAGTACACA
GGCTCCAGCCTCAAAACAGTCGAGCGGAATGTGGAAGATGATTATATCGCCAACCTCCGGAACAACTGCTGGAAGGAGAAGCAGCAGAAG
GAAGGCTTGCTGTACCGGGCACGCTACTTTGGCGACACAGATATGTACCACAGAGCACAGAAGATGGGCACCCCCAGCTGCAGCCGACTG
TCAGAGGTGCAGGCCTCCCTGCATGGATAGTCCTGGGCCAGCCACACCACCGAGGTCCAAGTATGAGCCAGGGCTGCCTCCACCCTGCAA
CTCCTGGCAGCTTTGGCCCTGGTCATGAGCAGAGGAGGGAGGGGGAGAAAGGGAGGAAGCCTGGTGATTGTGGCAAAGACTCCTGTCCCC
AGCCTGACCTCCAGCCTCCAGAGACCGAGCAGCTGTGGGGCCTGCTGGGAAACCAAGGTCGGTTTCCGCCCTCTAGCGATGCTGTCCTCC
CCACTCCTCCGCTCTGCTCCCTGGCTCCAGGGGTGTGGGGGACCCCAGAACCAGGCAGAGTGGGAACTTGAAACTGTTGCTGAGGGCCAC
CCGGGGCTTCTTGGTCCACTCCAGCCATCAGTCAGCACGGCCCTTTCTCCAGCACAGCAGACTATTGTCCGTGCCCTGGTATTTAGGCCA
TCACATATGGTGGGGCCCAAGAGAGCCCCATATGCACACTGCCTGCCTGATACCAGGAAGAACCATGTGGGAATAGGTGGGCCAAGAGCC
CTCCCCTTTCTCCATCCCTCCAGCTAGGAGGAAATGGAGCAAGATGAACAGGCAGCCACGAGGTGGGTGGGAGCTGGCAGTCTTGGTGGC
GGCAGGGGCCGCGGGCCCTGACCACCCCCCTCTGGTGGGATCTGAGGCACTCTCTCGAATGCCGTCACACCTGGCAGCCTGGAAGCCACA
GGCATCCGGCCTTGCCCAGGCATCTCGCCTGCGGTCTGAGGAAGGGAACAGAAGGTCATGAGTTCAGGGTCAGACGCAGCCGCTCAGCAC
AGGAGGGGTGGAGGGGAAATGAGAGTTGCTGGTAGCAGGCTCCCTCCTTCTGCAGCCCGGCGAATGGGGGCGCTGGGCTCTGTTCCCAGC
GTTTGCCAGAGGTGGCCACTTCAGCCAAGCCCAGAGAAGTGTGGGCAGAAGCAGTGAAGGTTCTTCTCTGTGTGGGTGCCCTGCCCACCC
CCTCCTTTGCCTGTGTCCTCCCGGCCTGGATCCATGGCTGACTCTGCCTGGAGGCCATTTGTGCCTGCCTCTGTGCTGCCGCAGGAGGGC
AGGCCGCAAGTGGGGTTGGTGGGGGTCGAGCGGGCAGCACGGTGCAGCGGTGCAGTGGCAAGGGGGGCTACTTGTGTGGCATAAGCTAGA
GGAGCCGGTGCCGCCTGAATGCCGAGCTAACTGTTGCCACTCTCCTCCCCAGACTATGAAATCCCTGGAGAATTTTTGGTGACATGCACT
GAGCCAAGGTGATGGACTGTATATTTGAGGAAAGACAAACAAAGAAACAAAATTAAAATGGAATTGGAGGCCGAACGCTGCACAGCTGCC
CTCTCTCTCACCCAGTAAATGCAGAAAGCTCTTAGGACAGACAGAAAACCTGCCATGGGGCTGCTTCCCTCCCTCGCAGGGCTGGCGGAG
GCTCCGCATCGCCTCTCTCCTAGGATACAGAAACCATGGCAACGAAAGTAGAATGTAAAACTCGCAGCAGATATCAGTGGGAAGGGCTGG
GGGAGGGGGCACCCAGCTGCCTTTCCTCCCTCACAGGAGCCACCACCAGCCACCTCTCAGGAGAAGCCAGAGGCCCTGGCCAAAGATAGG
AGGAAGAAAGAGAACTCTCCATAGAATGTAATTTATAGATGCGTGTATATGTATATATATCTATTTATATGTAAATAGGCATATATGAAG
ATATATATATATATAGTCTACTTTTTAAACTCTGCAGGGATTTGGTTAAGTTGTTGAGCTGATTTCTTCCATGTTTTAGAAAATGAGGCC
TGTTTGGGGAAGGTACCCTGGTGATGTTTTTGCTAGACATTAGCTGTAGCTGACAGCATAAGGAGAGTCGCATCAGAGCTTTTCACAGCC
CCCCGAAACCCCAGCCTGGTTTTGATGGCAGCAGTAATCATGATAGTGTGAACCCGCGAAGGCCTCAGGATTATGGTTAACCTGGAGAGG
AGCAGGCCATGGAGGCAGGTGCCAGGTCAGTATTGAGTCACAGTAGAGGCCCCACAAGGACCTGCTTGGGTGAGACCACCTCTCCCCTCT
CAGCAGCGCTGGTGGGCTCTTTGTCCTGGTGCCCAGGAGCCCTCCAGCCCCCTGCCCACAGAAGGGAAGGCCTGCAGAGGGGGCCAGGAT
CTACCTAACCATTTCCCCACCCCTAAGTCCCTCAGTGGGCTTTGCCTTATAGGTGCCACAGGGCACAGCTCCATCATTGCCACTGGTTTT
TCCTAAGTCATGCACCAAGGACTTCAGAAAGTTCTTCCTCCGAGTCAGTCAGTGGTGCCGGGACCCCAGGGCAGCCTCCTCGACTCCTGA
AGAAAAGGCAGTGCCCGTGGCTGCCTCTGTCTTCACTCGCTGTTGATGTGACCGCCAGGCCTCCTCTCGTACCTTGGACAAAGGATACAC
CTGAACCAGAATAGTTTTCTTACCCTCACATTGAAATGAGGATTTTGCTTAAAACAGCACTTGCCGCCAGTGGGAGGAGGGAGGTTTTAT
TTATTCCCACAGTTTCTCCTGGGCCTTCTGGAATGACCATGTTTTCCTGTGGCGGTGGGTGTGTCATTGCGCCCGCCGTCTTCCAAAGCC
TTACTTCCCCAAGCTGCCAGCCAGGAGGTGATAACCACCCTCCCAGAGTTTCTCTCGGCTCTTTTTTTAAAAGTCCCCCAACAAATAGGA
TTCTTGCTGGGAAAGGAAGTTCGGTAAGGAAATGTCAAATCTGGTTTTTAAACAAGGTCCAACCCTGCAATGAAGCAGCCACTTCAGCCC
AGAGAGATTATAAGAACTGATGTGGCCAGAGTGCCTACCCACTGTGGCCCCGGTGCTCTGCCCCCACGCCCCGACCATCTGGTCTTGGTA
GATGTCCCTAGACGGGCTGAGCCATGTGCAATAAGAACATAGATCCTAAAGGATCCTCTGGAAGCTGTATTTCTTGAATTAGAATTCTCA
AATTGTACATCTGTTAATATATGTTTATTATGTGACTGGCAAAAAAAAAAAAAAAAA

Gene Information
Molecule Type mRNA
Bases 4377 Bases
Molecular Weight1352330.89 Da
Coding Sequence 151..1380
NCBI ReferenceNM_001002762
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily B; member 12(DNAJB12); transcript variant 1; mRNA. dnaJhomologsubfamilyBmember12

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
SignalP 1 to 87 87 Signal peptide region Manually identified
J-domain 144 to 205 62 N-terminal DnaJ domain PF00226
DUF1977 295 to 403 109 Domain of unknown function (DUF1977) PF09320

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA50

Accession Number

HSP40_3223

Added on

2012-02-02

Updated On

2014-01-20